Property Summary

NCBI Gene PubMed Count 10
PubMed Score 107.19
PubTator Score 7.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
lung carcinoma 2844 3.36465152485058E-28
breast carcinoma 1614 1.4564046303878E-20
Breast cancer 3099 8.23639593206533E-9
malignant mesothelioma 3163 2.9989556928713E-6
ovarian cancer 8492 4.63821732111014E-6
pituitary cancer 1972 1.28864019949173E-5
posterior fossa group A ependymoma 1511 5.19241427152141E-5
medulloblastoma, large-cell 6234 1.63088056573617E-4
psoriasis 6685 7.00689192415734E-4
head and neck cancer 270 9.15637868068924E-4
cystic fibrosis 1670 0.00104489736254827
group 4 medulloblastoma 1875 0.00261607069398089
interstitial cystitis 2299 0.00279402766420948
cutaneous lupus erythematosus 1056 0.00455579288296599
invasive ductal carcinoma 2950 0.00898853218748007
astrocytic glioma 2241 0.00994606997363245
ulcerative colitis 2087 0.0155511150552244
gastric carcinoma 832 0.0320890489722006
primary pancreatic ductal adenocarcinoma 1271 0.0361065990215456
pancreatic cancer 2300 0.0441796140556616
aldosterone-producing adenoma 664 0.0448586456490037
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0467989209296436
Disease Target Count Z-score Confidence
Prostate cancer 172 0.0 1.0

Expression

  Differential Expression (22)

Synonym

Accession Q86SJ2 Q4VBP6 Q7Z4A0 Q96CN8
Symbols ALI1
DEGA
AMIGO-2

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Platypus OMA Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid

Pathway (1)

Gene RIF (3)

PMID Text
26553931 AMIGO2 is an important regulator of the PDK1-Akt pathway.
15107827 Stable expression of a DEGA/AMIGO-2 antisense construct led to altered morphology, increased ploidy, chromosomal instability, decreased cell adhesion/migration, and a nearly complete abrogation of tumorigenicity in nude mice.
12843293 Expression of ali1 promotes depolarization-dependent survival of cerebellar granule neurons. Mouse ali1 mapped to a chromosome 15 locus syntenic to candidate loci for familial Alzheimer's disease type 5 and Parkinson's disease 8 on human chromosome 12.

AA Sequence

MSLRVHTLPTLLGAVVRPGCRELLCLLMITVTVGPGASGVCPTACICATDIVSCTNKNLSKVPGNLFRLI      1 - 70
KRLDLSYNRIGLLDSEWIPVSFAKLNTLILRHNNITSISTGSFSTTPNLKCLDLSSNKLKTVKNAVFQEL     71 - 140
KVLEVLLLYNNHISYLDPSAFGGLSQLQKLYLSGNFLTQFPMDLYVGRFKLAELMFLDVSYNRIPSMPMH    141 - 210
HINLVPGKQLRGIYLHGNPFVCDCSLYSLLVFWYRRHFSSVMDFKNDYTCRLWSDSRHSRQVLLLQDSFM    211 - 280
NCSDSIINGSFRALGFIHEAQVGERLMVHCDSKTGNANTDFIWVGPDNRLLEPDKEMENFYVFHNGSLVI    281 - 350
ESPRFEDAGVYSCIAMNKQRLLNETVDVTINVSNFTVSRSHAHEAFNTAFTTLAACVASIVLVLLYLYLT    351 - 420
PCPCKCKTKRQKNMLHQSNAHSSILSPGPASDASADERKAGAGKRVVFLEPLKDTAAGQNGKVRLFPSEA    421 - 490
VIAEGILKSTRGKSDSDSVNSVFSDTPFVAST                                          491 - 522
//

Text Mined References (12)

PMID Year Title
26553931 2015 AMIGO2, a novel membrane anchor of PDK1, controls cell survival and angiogenesis via Akt activation.
22219177 2012 A genome-wide search for loci interacting with known prostate cancer risk-associated genetic variants.
21078624 2011 Comparison of an expanded ataxia interactome with patient medical records reveals a relationship between macular degeneration and ataxia.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15107827 2004 DEGA/AMIGO-2, a leucine-rich repeat family member, differentially expressed in human gastric adenocarcinoma: effects on ploidy, chromosomal stability, cell adhesion/migration and tumorigenicity.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12843293 2003 Alivin 1, a novel neuronal activity-dependent gene, inhibits apoptosis and promotes survival of cerebellar granule neurons.
More...