Property Summary

NCBI Gene PubMed Count 10
Grant Count 5
R01 Count 5
Funding $1,499,089
PubMed Score 107.19
PubTator Score 7.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Synonym

Accession Q86SJ2 Q4VBP6 Q7Z4A0 Q96CN8
Symbols ALI1
DEGA
AMIGO-2

Gene

Gene RIF (3)

PMID Text
26553931 AMIGO2 is an important regulator of the PDK1-Akt pathway.
15107827 Stable expression of a DEGA/AMIGO-2 antisense construct led to altered morphology, increased ploidy, chromosomal instability, decreased cell adhesion/migration, and a nearly complete abrogation of tumorigenicity in nude mice.
12843293 Expression of ali1 promotes depolarization-dependent survival of cerebellar granule neurons. Mouse ali1 mapped to a chromosome 15 locus syntenic to candidate loci for familial Alzheimer's disease type 5 and Parkinson's disease 8 on human chromosome 12.

AA Sequence

MSLRVHTLPTLLGAVVRPGCRELLCLLMITVTVGPGASGVCPTACICATDIVSCTNKNLSKVPGNLFRLI      1 - 70
KRLDLSYNRIGLLDSEWIPVSFAKLNTLILRHNNITSISTGSFSTTPNLKCLDLSSNKLKTVKNAVFQEL     71 - 140
KVLEVLLLYNNHISYLDPSAFGGLSQLQKLYLSGNFLTQFPMDLYVGRFKLAELMFLDVSYNRIPSMPMH    141 - 210
HINLVPGKQLRGIYLHGNPFVCDCSLYSLLVFWYRRHFSSVMDFKNDYTCRLWSDSRHSRQVLLLQDSFM    211 - 280
NCSDSIINGSFRALGFIHEAQVGERLMVHCDSKTGNANTDFIWVGPDNRLLEPDKEMENFYVFHNGSLVI    281 - 350
ESPRFEDAGVYSCIAMNKQRLLNETVDVTINVSNFTVSRSHAHEAFNTAFTTLAACVASIVLVLLYLYLT    351 - 420
PCPCKCKTKRQKNMLHQSNAHSSILSPGPASDASADERKAGAGKRVVFLEPLKDTAAGQNGKVRLFPSEA    421 - 490
VIAEGILKSTRGKSDSDSVNSVFSDTPFVAST                                          491 - 522
//

Text Mined References (12)

PMID Year Title
26553931 2015 AMIGO2, a novel membrane anchor of PDK1, controls cell survival and angiogenesis via Akt activation.
22219177 2012 A genome-wide search for loci interacting with known prostate cancer risk-associated genetic variants.
21078624 2011 Comparison of an expanded ataxia interactome with patient medical records reveals a relationship between macular degeneration and ataxia.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15107827 2004 DEGA/AMIGO-2, a leucine-rich repeat family member, differentially expressed in human gastric adenocarcinoma: effects on ploidy, chromosomal stability, cell adhesion/migration and tumorigenicity.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12843293 2003 Alivin 1, a novel neuronal activity-dependent gene, inhibits apoptosis and promotes survival of cerebellar granule neurons.
More...