Property Summary

NCBI Gene PubMed Count 7
PubMed Score 90.38
PubTator Score 1.17

Knowledge Summary

Patent

No data available

Gene RIF (1)

AA Sequence

MQHSLVFFFAVILHLSHLLHLDASIHPFRLPFSSKPFLLIPMSNTTLPHTAWPLSFLHQTVSTLKAVAVT      1 - 70
HSLWHLQIPVDCQACNRKSKKIYC                                                   71 - 94
//

Text Mined References (9)

PMID Year Title