Property Summary

NCBI Gene PubMed Count 7
Grant Count 2
Funding $172,831
PubMed Score 84.18
PubTator Score 1.17

Knowledge Summary

Patent

No data available

Gene RIF (1)

PMID Text
16889908 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MQHSLVFFFAVILHLSHLLHLDASIHPFRLPFSSKPFLLIPMSNTTLPHTAWPLSFLHQTVSTLKAVAVT      1 - 70
HSLWHLQIPVDCQACNRKSKKIYC                                                   71 - 94
//

Text Mined References (9)

PMID Year Title
20206252 2010 Genomic assessment of the evolution of the prion protein gene family in vertebrates.
17562432 2007 The prion protein family: diversity, rivalry, and dysfunction.
17199895 2007 Comparative genomic analysis of prion genes.
16889908 2006 Polymorphic microsatellite sites in the PRNP region point to excess of homozygotes in Creutzfeldt-Jakob disease patients.
16460908 2006 Comparative genomic organization of the human and bovine PRNP locus.
15342797 2004 Evolution of vertebrate genes related to prion and Shadoo proteins--clues from comparative genomic analysis.
12514748 2002 Genomic characterization of the human prion protein (PrP) gene locus.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.