Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.45
PubTator Score 3.50

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
21093056 HLysG2 is a potent antibacterial protein that may play a role in the innate immunity of the human eye.

AA Sequence

MLSSVVFWGLIALIGTSRGSYPFSHSMKPHLHPRLYHGCYGDIMTMKTSGATCDANSVMNCGIRGSEMFA      1 - 70
EMDLRAIKPYQTLIKEVGQRHCVDPAVIAAIISRESHGGSVLQDGWDHRGLKFGLMQLDKQTYHPVGAWD     71 - 140
SKEHLSQATGILTERIKAIQKKFPTWSVAQHLKGGLSAFKSGIEAIATPSDIDNDFVNDIIARAKFYKRQ    141 - 210
SF                                                                        211 - 212
//

Text Mined References (7)

PMID Year Title
21926972 2011 Large-scale genome-wide association analysis of bipolar disorder identifies a new susceptibility locus near ODZ4.
21093056 2011 Characterization and expression of HLysG2, a basic goose-type lysozyme from the human eye and testis.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12574869 2003 Molecular evolution of vertebrate goose-type lysozyme genes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.