Property Summary

NCBI Gene PubMed Count 13
Grant Count 1
Funding $54,194
PubMed Score 3.33
PubTator Score 14.15

Knowledge Summary

Patent

No data available

Gene RIF (6)

PMID Text
22747601 S100A15 retains the ability to coordinate zinc through incorporation of an exogenous ligand resulting in a unique zinc-binding site among S100 proteins.
18606705 study defines RAGE (receptor for advanced glycation end products) as the hS100A7 receptor, whereas hS100A15 functions through a Gi protein-coupled receptor
17625598 E. coli modulates S100A15 and IL-8 expression of keratinocytes by recognition through TLR4.
17620096 Overexpression of hS100A15 in chronic inflammatory skin diseases and regulation by inflammatory cytokines and calcium suggest that hS100A15 is involved in Th1-associated epithelial responses and epidermal maturation in normal and diseased human skin
16682778 The S100A15 protein has been expressed & purified to homogeneity in 2 crystal forms. Crystals of form I are triclinic. Crystals of form II are monoclinic & have a solvent content of 51.8%, corresponding to the presence of 1 monomer in the asymmetric unit.
12923069 Molecular cloning and characterization of alternatively spliced S100A15 isoforms from psoriatic skin.

AA Sequence

MSNTQAERSIIGMIDMFHKYTGRDGKIEKPSLLTMMKENFPNFLSACDKKGIHYLATVFEKKDKNEDKKI      1 - 70
DFSEFLSLLGDIAADYHKQSHGAAPCSGGSQ                                            71 - 101
//

Text Mined References (13)

PMID Year Title
22747601 2012 Structural characterization of S100A15 reveals a novel zinc coordination site among S100 proteins and altered surface chemistry with functional implications for receptor binding.
21148126 2010 Gene from a psoriasis susceptibility locus primes the skin for inflammation.
18606705 2008 Chemotactic activity of S100A7 (Psoriasin) is mediated by the receptor for advanced glycation end products and potentiates inflammation with highly homologous but functionally distinct S100A15.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17625598 2007 S100A15, an antimicrobial protein of the skin: regulation by E. coli through Toll-like receptor 4.
17620096 2007 Human S100A15 splice variants are differentially expressed in inflammatory skin diseases and regulated through Th1 cytokines and calcium.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16682778 2006 Purification, crystallization and preliminary X-ray diffraction of human S100A15.
12923069 2003 Molecular cloning and characterization of alternatively spliced mRNA isoforms from psoriatic skin encoding a novel member of the S100 family.
12664160 2003 Genomic and phylogenetic analysis of the S100A7 (Psoriasin) gene duplications within the region of the S100 gene cluster on human chromosome 1q21.
More...