Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00
PubTator Score 2.00

Knowledge Summary

Patent

No data available

Gene RIF (1)

PMID Text
15027122 identified the novel gene D-PCa-2 (Dresden prostate carcinoma 2), which is highly overexpressed in normal prostate tissue and prostate carcinoma; potential application in the diagnosis of prostate carcinoma

AA Sequence

MEPWAMRALDFADESGSVSCKDMHLLLWLQKRIEMHKAEQCEEEEAMTPRPTKARAPLPSAYVPPLSLPP      1 - 70
CPRERLKGMLKEIKPRLSRNCREDPQGCLLNLLLQSHSRSPERPLQRRERRYLQRRREKLMLARRGITLQ     71 - 140
KMEMPKQTRHRKLKVLEMPSEVCAFLITVYFW                                          141 - 172
//

Text Mined References (6)

PMID Year Title
24043589 2014 A new RNA-seq method to detect the transcription and non-coding RNA in prostate cancer.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
15027122 2004 D-PCa-2: a novel transcript highly overexpressed in human prostate and prostate cancer.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12727900 2003 Retroposed copies of the HMG genes: a window to genome dynamics.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.