Property Summary

NCBI Gene PubMed Count 31
PubMed Score 104.77
PubTator Score 5.43

Knowledge Summary

Patent

No data available

Gene RIF (6)

PMID Text
26232607 Studies indicate that partial RNA-binding proteins DAZ1/2 deletion was associated wih male infertility, but partial RNA-binding proteins DAZ3/4 deletion was not associated with male infertility.
24878370 Oligospermia seems to be promoted by removing DAZ4 copy. Deletion of DAZ2 and DAZ4 gene copies is associated with male infertility.
19223287 All four DAZ genes are expressed in the human testis, and their products are highly polymorphic among men
17416365 AZFc subdeletions do not seem to cause severe impairment of spermatogenesis in Chilean men.
16963411 Observational study of gene-disease association. (HuGE Navigator)
14639527 a common variant of the human Y chromosome lacks the DAZ3/DAZ4 and BPY2.2/BPY2.3 doublets in distal AZFc and thus these genes cannot be required for male fertility

AA Sequence

MSAANPETPNSTISREASTQSSSAAASQGWVLPEGKIVPNTVFVGGIDARMDETEIGSCFGRYGSVKEVK      1 - 70
IITNRTGVSKGYGFVSFVNDVDVQKIVGSQIHFHGKKLKLGPAIRKQKLCARHVQPRPLVVNPPPPPQFQ     71 - 140
NVWRNPNTETYLQPQITPNPVTQHVQSAANPETPNSTISREASTQSSSAAASQGWVLPEGKIVPNTVFVG    141 - 210
GIDARMDETEIGSCFGRYGSVKEVKIITNRTGVSKGYGFVSFVNDVDVQKIVGSQIHFHGKKLKLGPAIR    211 - 280
KQKLCARHVQPRPLVVNPPPPPQFQNVWRNPNTETYLQPQITPNPVTQHVQAYSAYPHSPGQVITGCQLL    281 - 350
VYNYQEYPTYPDSAFQVTTGYQLPVYNYQPFPAYPRSPFQVTAGYQLPVYNYQAFPAYPNSPFQVATGYQ    351 - 420
FPVYNYQPFPAYPSSPFQVTAGYQLPVYNYQAFPAYPNSPFQVATGYQFPVYNYQAFPAYPNSPVQVTTG    421 - 490
YQLPVYNYQAFPAYPSSPFQVTTGYQLPVYNYQAFPAYPNSAVQVTTGYQFHVYNYQMPPQCPVGEQRRN    491 - 560
LWTEAYKWWYLVCLIQRRD                                                       561 - 579
//

Text Mined References (33)

PMID Year Title
26232607 2015 Impact of partial DAZ1/2 deletion and partial DAZ3/4 deletion on male infertility.
24878370 2014 Combined deletion of DAZ2 and DAZ4 copies of Y chromosome DAZ gene is associated with male infertility in Tunisian men.
19223287 2009 Polymorphic expression of DAZ proteins in the human testis.
18385127 2008 Restricted expression of the human DAZ protein in premeiotic germ cells.
17416365 2007 AZFc partial deletions in Chilean men with severe spermatogenic failure.
16963411 2006 [Study on DAZ gene copy deletion in severe oligozoospermia sperm donor for ICSI].
16275261 2005 Copy number of DAZ genes in infertile men.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15066460 2004 Expression profiles of the DAZ gene family in human testis with and without spermatogenic failure.
15066457 2004 Analysis of the DAZ gene family in cryptorchidism and idiopathic male infertility.
More...