Property Summary

NCBI Gene PubMed Count 14
PubMed Score 19.56
PubTator Score 9.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.300 3.7e-05
Astrocytoma, Pilocytic -1.500 2.0e-09
atypical teratoid / rhabdoid tumor -1.800 1.1e-10
ependymoma -1.100 2.4e-03
glioblastoma -1.400 4.4e-10
group 3 medulloblastoma -1.300 1.0e-03
medulloblastoma, large-cell -1.400 5.0e-04
oligodendroglioma -1.100 2.9e-03
primitive neuroectodermal tumor -1.400 2.9e-05

Gene RIF (6)

AA Sequence

MNLSSASSTEEKAVTTVLWGCELSQERRTWTFRPQLEGKQSCRLLLHTICLGEKAKEEMHRVEILPPANQ      1 - 70
EDKKMQPVTIASLQASVLPMVSMVGVQLSPPVTFQLRAGSGPVFLSGQERYEASDLTWEEEEEEEGEEEE     71 - 140
EEEEDDEDEDADISLEEQSPVKQVKRLVPQKQASVAKKKKLEKEEEEIRASVRDKSPVKKAKATARAKKP    141 - 210
GFKK                                                                      211 - 214
//

Text Mined References (17)

PMID Year Title