Property Summary

NCBI Gene PubMed Count 12
PubMed Score 1.00
PubTator Score 13.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ulcerative colitis 1819 1.0e-07
active Crohn's disease 922 8.3e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (2)

Disease log2 FC p
active Crohn's disease -1.449 8.3e-03
ulcerative colitis -1.500 1.0e-07

Gene RIF (11)

AA Sequence

MRCPKCLLCLSALLTLLGLKVYIEWTSESRLSKAYPSPRGTPPSPTPANPEPTLPANLSTRLGQTIPLPF      1 - 70
AYWNQQQWRLGSLPSGDSTETGGCQAWGAAAATEIPDFASYPKDLRRFLLSAACRSFPQWLPGGGGSQVS     71 - 140
SCSDTDVPYLLLAVKSEPGRFAERQAVRETWGSPAPGIRLLFLLGSPVGEAGPDLDSLVAWESRRYSDLL    141 - 210
LWDFLDVPFNQTLKDLLLLAWLGRHCPTVSFVLRAQDDAFVHTPALLAHLRALPPASARSLYLGEVFTQA    211 - 280
MPLRKPGGPFYVPESFFEGGYPAYASGGGYVIAGRLAPWLLRAAARVAPFPFEDVYTGLCIRALGLVPQA    281 - 350
HPGFLTAWPADRTADHCAFRNLLLVRPLGPQASIRLWKQLQDPRLQC                           351 - 397
//

Text Mined References (13)

PMID Year Title