Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.00
PubTator Score 13.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (2)

Disease log2 FC p
active Crohn's disease -1.449 0.008
ulcerative colitis -1.500 0.000

Synonym

Accession Q7Z7M8 BGnT-8
Symbols B3GALT7
BGALT15
beta3Gn-T8

Gene

PANTHER Protein Class (2)

Gene RIF (10)

PMID Text
25269761 In conclusion, the alteration of b3GnT8 in colorectal cancer cells correlates with tumor sensitivity to the chemotherapeutic drug and has significant implication for the development of new treatment strategies.
24970053 Study shows that beta3GnT8 is involved in the regulation of CD147 N-glycosylation and further influences MMP-2 expression in tumor cells suggesting that it may play an important role in the CD147 signaling as an upstream modulator of MMP-2 in tumor cells.
24715095 The results demonstrated a critical role of beta3GnT8 in the metastatic potential of glioma cells, indicating that manipulating beta3GnT8 expression may have therapeutic potential for the treatment of malignant glioma.
24573103 we suggest that beta3GnT8 plays a key role in the metastasis of colorectal cancer cells by altering the beta1,6-branched polylactosamine sugars of CD147.
22901175 High beta3Gn-T8 expression is associated with laryngeal carcinoma.
21468598 The down-regulation of beta3Gn-T8 caused significant inhibition of tumor cell growth in vitro.
20963502 These results reveal a new mechanism by which beta3Gn-T8 can regulate MMP-2 and TIMP-2.
18826941 up-regulation of beta3Gn-T8 in differentiated cells increases poly-N-acetyllactosamine chains by activating intrinsic beta3Gn-T2.
15620693 The cloning of a novel beta1,3-N-acetylglucosaminyltransferase that is upregulated in a human colon cancer cell line.
15486459 highly expressed in lung, throat and ileum, whereas the expression level was low in tongue, breast, uteri, testis. In addition, it was also demonstrated that B3GALT7 is differentially transcribed in human tumor cell lines.

AA Sequence

MRCPKCLLCLSALLTLLGLKVYIEWTSESRLSKAYPSPRGTPPSPTPANPEPTLPANLSTRLGQTIPLPF      1 - 70
AYWNQQQWRLGSLPSGDSTETGGCQAWGAAAATEIPDFASYPKDLRRFLLSAACRSFPQWLPGGGGSQVS     71 - 140
SCSDTDVPYLLLAVKSEPGRFAERQAVRETWGSPAPGIRLLFLLGSPVGEAGPDLDSLVAWESRRYSDLL    141 - 210
LWDFLDVPFNQTLKDLLLLAWLGRHCPTVSFVLRAQDDAFVHTPALLAHLRALPPASARSLYLGEVFTQA    211 - 280
MPLRKPGGPFYVPESFFEGGYPAYASGGGYVIAGRLAPWLLRAAARVAPFPFEDVYTGLCIRALGLVPQA    281 - 350
HPGFLTAWPADRTADHCAFRNLLLVRPLGPQASIRLWKQLQDPRLQC                           351 - 397
//

Text Mined References (12)

PMID Year Title
25269761 2014 Knockdown of ?3GnT8 reverses 5-fluorouracil resistance in human colorectal cancer cells via inhibition the biosynthesis of polylactosamine-type N-glycans.
24970053 2014 ?3GnT8 plays an important role in CD147 signal transduction as an upstream modulator of MMP production in tumor cells.
24715095 2014 High expression of ?3GnT8 is associated with the metastatic potential of human glioma.
24573103 2014 ?3GnT8 regulates the metastatic potential of colorectal carcinoma cells by altering the glycosylation of CD147.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22901175 2012 ?3GnT8 regulates laryngeal carcinoma cell proliferation via targeting MMPs/TIMPs and TGF-?1.
21468598 Down-regulation of ?-1,3-N-acetylglucosaminyltransferase-8 by siRNA inhibits the growth of human gastric cancer.
20963502 2011 Regulation of MMP-2 expression and activity by ?-1,3-N-acetylglucosaminyltransferase-8 in AGS gastric cancer cells.
18826941 2008 Activation of beta1,3-N-acetylglucosaminyltransferase-2 (beta3Gn-T2) by beta3Gn-T8. Possible involvement of beta3Gn-T8 in increasing poly-N-acetyllactosamine chains in differentiated HL-60 cells.
15917431 2005 Characterization of a novel galactose beta1,3-N-acetylglucosaminyltransferase (beta3Gn-T8): the complex formation of beta3Gn-T2 and beta3Gn-T8 enhances enzymatic activity.
More...