Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.36
PubTator Score 0.25

Knowledge Summary

Patent (256)

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.500 1.3e-03
Amyotrophic lateral sclerosis -1.184 1.2e-04
atypical teratoid / rhabdoid tumor -1.500 1.3e-05
autosomal dominant Emery-Dreifuss muscul... -1.074 3.2e-02
glioblastoma -1.600 4.2e-05
group 4 medulloblastoma -1.100 1.4e-02
juvenile dermatomyositis -1.327 1.9e-09
medulloblastoma, large-cell -1.500 3.9e-04
non primary Sjogren syndrome sicca 1.300 1.1e-02
non-inflammatory breast cancer -1.100 1.7e-05
ovarian cancer -1.200 4.9e-06
psoriasis -1.300 1.3e-17

Gene RIF (1)

AA Sequence

MDAPWGAGERWLHGAAVDRSGVSLGPPPTPQVNQGTLGPQVAPVAAGEVVKTAGGVCKFSGQRLSWWQAQ      1 - 70
ESCEQQFGHLALQPPDGVLASRLRDPVWVGQREAPLRRPPQRRARTTAVLVFDERTADRAARLRSPLPEL     71 - 140
AALTACTHVQWDCASPDPAALFSVAAPALPNALQLRAFAEPGGVVRAALVVRGQHAPFLAAFRADGRWHH    141 - 210
VCATWEQRGGRWALFSDGRRRAGARGLGAGHPVPSGGILVLGQDQDSLGGGFSVRHALSGNLTDFHLWAR    211 - 280
ALSPAQLHRARACAPPSEGLLFRWDPGALDVTPSLLPTVWVRLLCPVPSEECPTWNPGPRSEGSELCLEP    281 - 350
QPFLCCYRTEPYRRLQDAQSWPGQDVISRVNALANDIVLLPDPLSEVHGALSPAEASSFLGLLEHVLAME    351 - 420
MAPLGPAALLAVVRFLKRVVALGAGDPELLLTGPWEQLSQGVVSVASLVLEEQVADTWLSLREVIGGPMA    421 - 490
LVASVQRLAPLLSTSMTSERPRMRIQHRHAGLSGVTVIHSWFTSRVFQHTLEGPDLEPQAPASSEEANRV    491 - 560
QRFLSTQVGSAIISSEVWDVTGEVNVAMTFHLQHRAQSPLFPPHPPSPYTGGAWATTGCSVAALYLDSTA    561 - 630
CFCNHSTSFAILLQIYEVQRGPEEESLLRTLSFVGCGVSFCALTTTFLLFLVAGVPKSERTTVHKNLTFS    631 - 700
LASAEGFLMTSEWAKANEVACVAVTVAMHFLFLVAFSWMLVEGLLLWRKVVAVSMHPGPGMRLYHATGWG    701 - 770
VPVGIVAVTLAMLPHDYVAPGHCWLNVHTNAIWAFVGPVLFVLTANTCILARVVMITVSSARRRARMLSP    771 - 840
QPCLQQQIWTQIWATVKPVLVLLPVLGLTWLAGILVHLSPAWAYAAVGLNSIQGLYIFLVYAACNEEVRS    841 - 910
ALQRMAEKKVAEVLRALGVWGGAAKEHSLPFSVLPLFLPPKPSTPRHPLKAPA                     911 - 963
//

Text Mined References (7)

PMID Year Title