Property Summary

NCBI Gene PubMed Count 7
PubMed Score 13.24
PubTator Score 1.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
glioblastoma 5572 4.84511539249728E-10
sonic hedgehog group medulloblastoma 1482 3.30287241819046E-7
adult high grade glioma 2148 3.91760631457564E-5
medulloblastoma, large-cell 6234 3.95259203616057E-5
osteosarcoma 7933 1.2008225862083E-4
psoriasis 6685 8.43750173478672E-4
spina bifida 1064 0.0412732929548181

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis -1.100 0.001
osteosarcoma -1.275 0.000
glioblastoma -1.200 0.000
sonic hedgehog group medulloblastoma -1.500 0.000
medulloblastoma, large-cell -1.400 0.000
adult high grade glioma -1.100 0.000
spina bifida -1.061 0.041

Synonym

Accession Q7Z7L7 O00156 Q5T272 Q5T273
Symbols ZYG
C9orf60
ZYG11BL

Gene

  Ortholog (13)

AA Sequence

MASDTPESLMALCTDFCLRNLDGTLGYLLDKETLRLHPDIFLPSEICDRLVNEYVELVNAACNFEPHESF      1 - 70
FSLFSDPRSTRLTRIHLREDLVQDQDLEAIRKQDLVELYLTNCEKLSAKSLQTLRSFSHTLVSLSLFGCT     71 - 140
NIFYEEENPGGCEDEYLVNPTCQVLVKDFTFEGFSRLRFLNLGRMIDWVPVESLLRPLNSLAALDLSGIQ    141 - 210
TSDAAFLTQWKDSLVSLVLYNMDLSDDHIRVIVQLHKLRHLDISRDRLSSYYKFKLTREVLSLFVQKLGN    211 - 280
LMSLDISGHMILENCSISKMEEEAGQTSIEPSKSSIIPFRALKRPLQFLGLFENSLCRLTHIPAYKVSGD    281 - 350
KNEEQVLNAIEAYTEHRPEITSRAINLLFDIARIERCNQLLRALKLVITALKCHKYDRNIQVTGSAALFY    351 - 420
LTNSEYRSEQSVKLRRQVIQVVLNGMESYQEVTVQRNCCLTLCNFSIPEELEFQYRRVNELLLSILNPTR    421 - 490
QDESIQRIAVHLCNALVCQVDNDHKEAVGKMGFVVTMLKLIQKKLLDKTCDQVMEFSWSALWNITDETPD    491 - 560
NCEMFLNFNGMKLFLDCLKEFPEKQELHRNMLGLLGNVAEVKELRPQLMTSQFISVFSNLLESKADGIEV    561 - 630
SYNACGVLSHIMFDGPEAWGVCEPQREEVEERMWAAIQSWDINSRRNINYRSFEPILRLLPQGISPVSQH    631 - 700
WATWALYNLVSVYPDKYCPLLIKEGGMPLLRDIIKMATARQETKEMARKVIEHCSNFKEENMDTSR        701 - 766
//

Text Mined References (8)

PMID Year Title
24144296 2013 Nine loci for ocular axial length identified through genome-wide association studies, including shared loci with refractive error.
23568457 2013 Genetic variants associated with disordered eating.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
17304241 2007 The Caenorhabditis elegans cell-cycle regulator ZYG-11 defines a conserved family of CUL-2 complex components.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11719588 2001 Meiotic human sperm cells express a leucine-rich homologue of Caenorhabditis elegans early embryogenesis gene, Zyg-11.