Property Summary

NCBI Gene PubMed Count 7
PubMed Score 15.60
PubTator Score 1.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
glioblastoma 5792 4.8e-10
adult high grade glioma 3801 3.9e-05
medulloblastoma, large-cell 6241 4.0e-05
osteosarcoma 7950 1.2e-04
group 3 medulloblastoma 4104 4.8e-04
psoriasis 6694 8.4e-04
spina bifida 1074 4.1e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma -1.100 3.9e-05
glioblastoma -1.200 4.8e-10
group 3 medulloblastoma -1.200 4.8e-04
medulloblastoma, large-cell -1.400 4.0e-05
osteosarcoma -1.275 1.2e-04
psoriasis -1.100 8.4e-04
spina bifida -1.061 4.1e-02

Synonym

Accession Q7Z7L7 O00156 Q5T272 Q5T273
Symbols ZYG
C9orf60
ZYG11BL

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MASDTPESLMALCTDFCLRNLDGTLGYLLDKETLRLHPDIFLPSEICDRLVNEYVELVNAACNFEPHESF      1 - 70
FSLFSDPRSTRLTRIHLREDLVQDQDLEAIRKQDLVELYLTNCEKLSAKSLQTLRSFSHTLVSLSLFGCT     71 - 140
NIFYEEENPGGCEDEYLVNPTCQVLVKDFTFEGFSRLRFLNLGRMIDWVPVESLLRPLNSLAALDLSGIQ    141 - 210
TSDAAFLTQWKDSLVSLVLYNMDLSDDHIRVIVQLHKLRHLDISRDRLSSYYKFKLTREVLSLFVQKLGN    211 - 280
LMSLDISGHMILENCSISKMEEEAGQTSIEPSKSSIIPFRALKRPLQFLGLFENSLCRLTHIPAYKVSGD    281 - 350
KNEEQVLNAIEAYTEHRPEITSRAINLLFDIARIERCNQLLRALKLVITALKCHKYDRNIQVTGSAALFY    351 - 420
LTNSEYRSEQSVKLRRQVIQVVLNGMESYQEVTVQRNCCLTLCNFSIPEELEFQYRRVNELLLSILNPTR    421 - 490
QDESIQRIAVHLCNALVCQVDNDHKEAVGKMGFVVTMLKLIQKKLLDKTCDQVMEFSWSALWNITDETPD    491 - 560
NCEMFLNFNGMKLFLDCLKEFPEKQELHRNMLGLLGNVAEVKELRPQLMTSQFISVFSNLLESKADGIEV    561 - 630
SYNACGVLSHIMFDGPEAWGVCEPQREEVEERMWAAIQSWDINSRRNINYRSFEPILRLLPQGISPVSQH    631 - 700
WATWALYNLVSVYPDKYCPLLIKEGGMPLLRDIIKMATARQETKEMARKVIEHCSNFKEENMDTSR        701 - 766
//

Text Mined References (8)

PMID Year Title