Property Summary

NCBI Gene PubMed Count 16
Grant Count 5
Funding $384,378.15
PubMed Score 15.34
PubTator Score 9.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Gene RIF (5)

PMID Text
26658330 SLFN11 inhibits checkpoint maintenance and homologous recombination repair by promoting the destabilization of the RPA-ssDNA complex, thereby sensitizing cancer cell lines expressing high endogenous levels of SLFN11 to DNA-damaging agents.
26525741 SLFN11 expression predicts good better survival in colorectal cancer patients with KRAS exon 2 wild type who have received oxaliplatin based adjuvant chemotherapy.
25779942 SLFN11 has a role as a transcriptional target of EWS-FLI1 and is a determinant of drug response in Ewing sarcoma
23000900 SLFN11 selectively inhibits viral protein synthesis in HIV-infected cells by means of codon-bias discrimination
22927417 SLFN11 expression is causally associated with the activity of DNA-damaging agents in cancer cells, and has a broad expression range in colon and ovarian adenocarcinomas.

AA Sequence

MEANQCPLVVEPSYPDLVINVGEVTLGEENRKKLQKIQRDQEKERVMRAACALLNSGGGVIRMAKKVEHP      1 - 70
VEMGLDLEQSLRELIQSSDLQAFFETKQQGRCFYIFVKSWSSGPFPEDRSVKPRLCSLSSSLYRRSETSV     71 - 140
RSMDSREAFCFLKTKRKPKILEEGPFHKIHKGVYQELPNSDPADPNSDPADLIFQKDYLEYGEILPFPES    141 - 210
QLVEFKQFSTKHFQEYVKRTIPEYVPAFANTGGGYLFIGVDDKSREVLGCAKENVDPDSLRRKIEQAIYK    211 - 280
LPCVHFCQPQRPITFTLKIVNVLKRGELYGYACMIRVNPFCCAVFSEAPNSWIVEDKYVCSLTTEKWVGM    281 - 350
MTDTDPDLLQLSEDFECQLSLSSGPPLSRPVYSKKGLEHKKELQQLLFSVPPGYLRYTPESLWRDLISEH    351 - 420
RGLEELINKQMQPFFRGILIFSRSWAVDLNLQEKPGVICDALLIAQNSTPILYTILREQDAEGQDYCTRT    421 - 490
AFTLKQKLVNMGGYTGKVCVRAKVLCLSPESSAEALEAAVSPMDYPASYSLAGTQHMEALLQSLVIVLLG    491 - 560
FRSLLSDQLGCEVLNLLTAQQYEIFSRSLRKNRELFVHGLPGSGKTIMAMKIMEKIRNVFHCEAHRILYV    561 - 630
CENQPLRNFISDRNICRAETRKTFLRENFEHIQHIVIDEAQNFRTEDGDWYGKAKSITRRAKGGPGILWI    631 - 700
FLDYFQTSHLDCSGLPPLSDQYPREELTRIVRNADPIAKYLQKEMQVIRSNPSFNIPTGCLEVFPEAEWS    701 - 770
QGVQGTLRIKKYLTVEQIMTCVADTCRRFFDRGYSPKDVAVLVSTAKEVEHYKYELLKAMRKKRVVQLSD    771 - 840
ACDMLGDHIVLDSVRRFSGLERSIVFGIHPRTADPAILPNVLICLASRAKQHLYIFPWGGH             841 - 901
//

Text Mined References (20)

PMID Year Title
26658330 2016 SLFN11 inhibits checkpoint maintenance and homologous recombination repair.
26525741 2015 High SLFN11 expression predicts better survival for patients with KRAS exon 2 wild type colorectal cancer after treated with adjuvant oxaliplatin-based treatment.
25779942 2015 SLFN11 Is a Transcriptional Target of EWS-FLI1 and a Determinant of Drug Response in Ewing Sarcoma.
23570387 2013 The schlafen family of proteins and their regulation by interferons.
23000900 2012 Codon-usage-based inhibition of HIV protein synthesis by human schlafen 11.
22927417 2012 Putative DNA/RNA helicase Schlafen-11 (SLFN11) sensitizes cancer cells to DNA-damaging agents.
21269460 2011 Initial characterization of the human central proteome.
20956525 2010 Role of interferon {alpha} (IFN{alpha})-inducible Schlafen-5 in regulation of anchorage-independent growth and invasion of malignant melanoma cells.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
More...