Property Summary

NCBI Gene PubMed Count 19
PubMed Score 19.13
PubTator Score 9.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
acute myeloid leukemia -1.900 4.7e-02
adult high grade glioma 1.800 6.5e-04
Astrocytoma, Pilocytic 1.400 5.0e-04
atypical teratoid / rhabdoid tumor 2.600 9.7e-05
cystic fibrosis 1.400 2.7e-03
ependymoma 1.800 1.6e-05
gastric carcinoma 1.300 2.6e-02
glioblastoma 1.500 6.2e-04
interstitial cystitis 1.500 5.6e-04
intraductal papillary-mucinous adenoma (... -1.300 2.0e-03
lung carcinoma -2.700 1.6e-30
non-small cell lung cancer -1.324 1.6e-12
osteosarcoma -1.376 2.2e-02
ovarian cancer -2.500 1.5e-08
pituitary cancer -1.200 1.1e-06
sonic hedgehog group medulloblastoma 1.500 3.1e-02
ulcerative colitis 1.700 1.4e-04

Gene RIF (8)

AA Sequence

MEANQCPLVVEPSYPDLVINVGEVTLGEENRKKLQKIQRDQEKERVMRAACALLNSGGGVIRMAKKVEHP      1 - 70
VEMGLDLEQSLRELIQSSDLQAFFETKQQGRCFYIFVKSWSSGPFPEDRSVKPRLCSLSSSLYRRSETSV     71 - 140
RSMDSREAFCFLKTKRKPKILEEGPFHKIHKGVYQELPNSDPADPNSDPADLIFQKDYLEYGEILPFPES    141 - 210
QLVEFKQFSTKHFQEYVKRTIPEYVPAFANTGGGYLFIGVDDKSREVLGCAKENVDPDSLRRKIEQAIYK    211 - 280
LPCVHFCQPQRPITFTLKIVNVLKRGELYGYACMIRVNPFCCAVFSEAPNSWIVEDKYVCSLTTEKWVGM    281 - 350
MTDTDPDLLQLSEDFECQLSLSSGPPLSRPVYSKKGLEHKKELQQLLFSVPPGYLRYTPESLWRDLISEH    351 - 420
RGLEELINKQMQPFFRGILIFSRSWAVDLNLQEKPGVICDALLIAQNSTPILYTILREQDAEGQDYCTRT    421 - 490
AFTLKQKLVNMGGYTGKVCVRAKVLCLSPESSAEALEAAVSPMDYPASYSLAGTQHMEALLQSLVIVLLG    491 - 560
FRSLLSDQLGCEVLNLLTAQQYEIFSRSLRKNRELFVHGLPGSGKTIMAMKIMEKIRNVFHCEAHRILYV    561 - 630
CENQPLRNFISDRNICRAETRKTFLRENFEHIQHIVIDEAQNFRTEDGDWYGKAKSITRRAKGGPGILWI    631 - 700
FLDYFQTSHLDCSGLPPLSDQYPREELTRIVRNADPIAKYLQKEMQVIRSNPSFNIPTGCLEVFPEAEWS    701 - 770
QGVQGTLRIKKYLTVEQIMTCVADTCRRFFDRGYSPKDVAVLVSTAKEVEHYKYELLKAMRKKRVVQLSD    771 - 840
ACDMLGDHIVLDSVRRFSGLERSIVFGIHPRTADPAILPNVLICLASRAKQHLYIFPWGGH             841 - 901
//

Text Mined References (23)

PMID Year Title