Property Summary

NCBI Gene PubMed Count 7
PubMed Score 440.01
PubTator Score 441.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

 GO Function (1)

Gene RIF (1)

AA Sequence

MRRSRSSAAAKLRGQKRSGASGASAAPAASAAAALAPSATRTRRSASQAGSKSQAVEKPPSEKPRLRRSS      1 - 70
PRAQEEGPGEPPPPELALLPPPPPPPPTPATPTSSASNLDLGEQRERWETFQKRQKLTSEGAAKLLLDTF     71 - 140
EYQGLVKHTGGCHCGAVRFEVWASADLHIFDCNCSICKKKQNRHFIVPASRFKLLKGAEHITTYTFNTHK    141 - 210
AQHTFCKRCGVQSFYTPRSNPGGFGIAPHCLDEGTVRSMVTEEFNGSDWEKAMKEHKTIKNMSKE         211 - 275
//

Text Mined References (12)

PMID Year Title