Property Summary

NCBI Gene PubMed Count 7
Grant Count 51
R01 Count 14
Funding $8,046,578.38
PubMed Score 432.88
PubTator Score 441.26

Knowledge Summary

Patent

No data available

Expression

 GO Function (1)

Gene RIF (1)

PMID Text
18772885 Results suggest that CENP-V (nuclear protein p30) is required for centromere organization, chromosome alignment and cytokinesis in human cells

AA Sequence

MRRSRSSAAAKLRGQKRSGASGASAAPAASAAAALAPSATRTRRSASQAGSKSQAVEKPPSEKPRLRRSS      1 - 70
PRAQEEGPGEPPPPELALLPPPPPPPPTPATPTSSASNLDLGEQRERWETFQKRQKLTSEGAAKLLLDTF     71 - 140
EYQGLVKHTGGCHCGAVRFEVWASADLHIFDCNCSICKKKQNRHFIVPASRFKLLKGAEHITTYTFNTHK    141 - 210
AQHTFCKRCGVQSFYTPRSNPGGFGIAPHCLDEGTVRSMVTEEFNGSDWEKAMKEHKTIKNMSKE         211 - 275
//

Text Mined References (12)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22959728 2013 Age of onset of amyotrophic lateral sclerosis is modulated by a locus on 1p34.1.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19930468 2009 Identification of CENP-V as a novel microtubule-associating molecule that activates Src family kinases through SH3 domain interaction.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18772885 2008 CENP-V is required for centromere organization, chromosome alignment and cytokinesis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...