Property Summary

NCBI Gene PubMed Count 6
PubMed Score 9.93
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
malignant mesothelioma 3232 6.2e-09
tuberculosis 2010 4.6e-05
osteosarcoma 7950 2.2e-03
invasive ductal carcinoma 2951 2.8e-03
group 3 medulloblastoma 4104 2.9e-03
lung cancer 4740 1.4e-02
spina bifida 1074 3.7e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (7)

Disease log2 FC p
group 3 medulloblastoma -1.100 2.9e-03
invasive ductal carcinoma 1.300 2.8e-03
lung cancer -1.100 1.4e-02
malignant mesothelioma 2.900 6.2e-09
osteosarcoma -1.454 2.2e-03
spina bifida 1.039 3.7e-02
tuberculosis 1.500 4.6e-05

Gene RIF (2)

AA Sequence

MRETLEALSSLGFSVGQPEMAPQSEPREGSHNAQEQMSSSREERALGVCSGHEAPTPEEGAHTEQAEAPC      1 - 70
RGQACSAQKAQPVGTCPGEEWMIRKVKVEDEDQEAEEEVEWPQHLSLLPSPFPAPDLGHLAAAYKLEPGA     71 - 140
PGALSGLALSGWGPMPEKPYGCGECERRFRDQLTLRLHQRLHRGEGPCACPDCGRSFTQRAHMLLHQRSH    141 - 210
RGERPFPCSECDKRFSKKAHLTRHLRTHTGERPYPCAECGKRFSQKIHLGSHQKTHTGERPFPCTECEKR    211 - 280
FRKKTHLIRHQRIHTGERPYQCAQCARSFTHKQHLVRHQRVHQTAGPARPSPDSSASPHSTAPSPTPSFP    281 - 350
GPKPFACSDCGLSFGWKKNLATHQCLHRSEGRPFGCDECALGATVDAPAAKPLASAPGGPGCGPGSDPVV    351 - 420
PQRAPSGERSFFCPDCGRGFSHGQHLARHPRVHTGERPFACTQCDRRFGSRPNLVAHSRAHSGARPFACA    421 - 490
QCGRRFSRKSHLGRHQAVHTGSRPHACAVCARSFSSKTNLVRHQAIHTGSRPFSCPQCGKSFSRKTHLVR    491 - 560
HQLIHGEAAHAAPDAALAAPAWSAPPEVAPPPLFF                                       561 - 595
//

Text Mined References (7)

PMID Year Title