Property Summary

NCBI Gene PubMed Count 6
PubMed Score 8.93
PubTator Score 2.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma 2.900 0.000
osteosarcoma -1.454 0.002
tuberculosis 1.500 0.000
lung cancer -1.100 0.014
group 3 medulloblastoma -1.100 0.003
spina bifida 1.039 0.037
invasive ductal carcinoma 1.300 0.003

Gene RIF (2)

PMID Text
22700861 ZNF467 gene DNA methylation is importants in the pathogenesis of idiopathic pulmonary fibrosis.
17848547 These results identify EZI as a novel cargo protein for importin-7 and demonstrate a nucleocytoplasmic shuttling mechanism that is mediated by importin-7-dependent nuclear localization and CRM1-independent nuclear export.

AA Sequence

MRETLEALSSLGFSVGQPEMAPQSEPREGSHNAQEQMSSSREERALGVCSGHEAPTPEEGAHTEQAEAPC      1 - 70
RGQACSAQKAQPVGTCPGEEWMIRKVKVEDEDQEAEEEVEWPQHLSLLPSPFPAPDLGHLAAAYKLEPGA     71 - 140
PGALSGLALSGWGPMPEKPYGCGECERRFRDQLTLRLHQRLHRGEGPCACPDCGRSFTQRAHMLLHQRSH    141 - 210
RGERPFPCSECDKRFSKKAHLTRHLRTHTGERPYPCAECGKRFSQKIHLGSHQKTHTGERPFPCTECEKR    211 - 280
FRKKTHLIRHQRIHTGERPYQCAQCARSFTHKQHLVRHQRVHQTAGPARPSPDSSASPHSTAPSPTPSFP    281 - 350
GPKPFACSDCGLSFGWKKNLATHQCLHRSEGRPFGCDECALGATVDAPAAKPLASAPGGPGCGPGSDPVV    351 - 420
PQRAPSGERSFFCPDCGRGFSHGQHLARHPRVHTGERPFACTQCDRRFGSRPNLVAHSRAHSGARPFACA    421 - 490
QCGRRFSRKSHLGRHQAVHTGSRPHACAVCARSFSSKTNLVRHQAIHTGSRPFSCPQCGKSFSRKTHLVR    491 - 560
HQLIHGEAAHAAPDAALAAPAWSAPPEVAPPPLFF                                       561 - 595
//

Text Mined References (6)

PMID Year Title
22700861 2012 Altered DNA methylation profile in idiopathic pulmonary fibrosis.
21123171 2011 Zinc finger protein 467 is a novel regulator of osteoblast and adipocyte commitment.
17848547 2007 Nucleocytoplasmic shuttling of the zinc finger protein EZI Is mediated by importin-7-dependent nuclear import and CRM1-independent export mechanisms.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12426389 2002 A novel nuclear zinc finger protein EZI enhances nuclear retention and transactivation of STAT3.