Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.15
PubTator Score 2.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (31)

Synonym

Accession Q7Z7J9
Symbols PRO1489

Gene

Gene RIF (4)

PMID Text
26175272 Hypermethylation of RUNX3/CAMK2N1 is associated with poor clinical outcome in Type II EOC, also after macroscopic complete resection.
25296973 contributes to prostate cancer growth and survival through androgen receptor-dependent signaling
25003983 Analyses suggest that CAMK2N1 plays a tumor suppressive role in prostate cancer cells. Reduced CAMK2N1 expression correlates to human prostate cancer progression and predicts poor clinical outcome.
18305109 hCaMKIINalpha suppresses tumor growth by inducing cell cycle arrest via p27 stabilization

AA Sequence

MSEVLPYGDEKLSPYGDGGDVGQIFSCRLQDTNNFFGAGQNKRPPKLGQIGRSKRVVIEDDRIDDVLKNM      1 - 70
TDKAPPGV                                                                   71 - 78
//

Text Mined References (8)

PMID Year Title
26175272 2016 RUNX3 and CAMK2N1 hypermethylation as prognostic marker for epithelial ovarian cancer.
25296973 2014 CAMK2N1 inhibits prostate cancer progression through androgen receptor-dependent signaling.
25003983 2014 The tumor suppressive role of CAMK2N1 in castration-resistant prostate cancer.
18305109 2008 A novel endogenous human CaMKII inhibitory protein suppresses tumor growth by inducing cell cycle arrest via p27 stabilization.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
12650977 2003 Autophosphorylated calcium/calmodulin-dependent protein kinase II alpha (CaMKII alpha) reversibly targets to and phosphorylates N-methyl-D-aspartate receptor subunit 2B (NR2B) in cerebral ischemia and reperfusion in hippocampus of rats.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12175859 Phosphorylation of the recombinant rho1 GABA receptor.