Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.98
PubTator Score 2.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (31)

Disease log2 FC p
active Crohn's disease -1.298 4.6e-03
adult high grade glioma -1.400 4.9e-03
astrocytic glioma -1.900 6.5e-03
Astrocytoma, Pilocytic -1.300 1.9e-04
atypical teratoid / rhabdoid tumor -2.900 4.7e-06
Breast cancer 2.200 4.4e-02
colon cancer -1.600 5.1e-06
ependymoma -4.100 1.3e-02
gastric carcinoma 1.800 4.2e-02
glioblastoma -1.500 1.7e-04
group 3 medulloblastoma -2.900 2.5e-04
head and neck cancer -1.500 2.4e-02
interstitial cystitis -1.200 1.4e-02
intraductal papillary-mucinous carcinoma... 1.800 1.8e-02
intraductal papillary-mucinous neoplasm ... 2.600 1.5e-02
invasive ductal carcinoma 1.500 8.5e-04
lung adenocarcinoma -1.200 3.0e-11
lung cancer -2.800 3.2e-05
malignant mesothelioma -1.600 4.7e-07
medulloblastoma, large-cell -3.400 2.3e-04
nephrosclerosis -1.463 9.3e-04
non-small cell lung cancer -2.349 1.4e-18
oligodendroglioma -1.700 2.6e-02
ovarian cancer -1.400 2.6e-02
pancreatic cancer 1.300 5.8e-04
pituitary cancer 1.700 3.5e-08
primary pancreatic ductal adenocarcinoma 2.217 1.7e-03
primitive neuroectodermal tumor -1.600 5.5e-04
psoriasis -1.900 2.3e-09
spina bifida -1.727 3.7e-02
ulcerative colitis -1.700 2.7e-06

Gene RIF (5)

AA Sequence

MSEVLPYGDEKLSPYGDGGDVGQIFSCRLQDTNNFFGAGQNKRPPKLGQIGRSKRVVIEDDRIDDVLKNM      1 - 70
TDKAPPGV                                                                   71 - 78
//

Text Mined References (9)

PMID Year Title