Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.15
PubTator Score 2.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung cancer 2798 1.41760874648695E-18
posterior fossa group B ependymoma 1530 9.85673730559748E-16
pituitary cancer 1972 3.46136987878951E-8
lung adenocarcinoma 2714 8.64592850942136E-8
malignant mesothelioma 3163 4.68165593314126E-7
lung cancer 4473 6.53727947607669E-7
glioblastoma 5572 2.06685756632031E-6
ulcerative colitis 2087 2.67956266202827E-6
colon cancer 1475 5.09786293324759E-6
atypical teratoid / rhabdoid tumor 4369 1.51048954873211E-5
pilocytic astrocytoma 3086 1.73300235199228E-5
psoriasis 6685 1.78178654723188E-5
group 3 medulloblastoma 2254 1.70595610524542E-4
adult high grade glioma 2148 9.01110106922498E-4
nephrosclerosis 329 9.30921272732982E-4
primitive neuroectodermal tumor 3031 0.00115190140222493
primary pancreatic ductal adenocarcinoma 1271 0.00171026233802121
medulloblastoma, large-cell 6234 0.00184725603651109
pancreatic cancer 2300 0.00186605404812823
invasive ductal carcinoma 2950 0.00294207593897085
active Crohn's disease 918 0.00463847215628787
oligodendroglioma 2849 0.0100495659338444
interstitial cystitis 2299 0.0140378797821828
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0145492291924112
astrocytoma 1493 0.0151335244688455
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0178100530183072
head and neck cancer 270 0.0237065323623843
gastric carcinoma 832 0.0245791858189446
ovarian cancer 8492 0.0262348730930144
spina bifida 1064 0.0373936224288373
Breast cancer 3099 0.0435772632438607

Expression

  Differential Expression (31)

Synonym

Accession Q7Z7J9
Symbols PRO1489

Gene

  Ortholog (5)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Xenopus OMA EggNOG

Gene RIF (4)

PMID Text
26175272 Hypermethylation of RUNX3/CAMK2N1 is associated with poor clinical outcome in Type II EOC, also after macroscopic complete resection.
25296973 contributes to prostate cancer growth and survival through androgen receptor-dependent signaling
25003983 Analyses suggest that CAMK2N1 plays a tumor suppressive role in prostate cancer cells. Reduced CAMK2N1 expression correlates to human prostate cancer progression and predicts poor clinical outcome.
18305109 hCaMKIINalpha suppresses tumor growth by inducing cell cycle arrest via p27 stabilization

AA Sequence

MSEVLPYGDEKLSPYGDGGDVGQIFSCRLQDTNNFFGAGQNKRPPKLGQIGRSKRVVIEDDRIDDVLKNM      1 - 70
TDKAPPGV                                                                   71 - 78
//

Text Mined References (8)

PMID Year Title
26175272 2016 RUNX3 and CAMK2N1 hypermethylation as prognostic marker for epithelial ovarian cancer.
25296973 2014 CAMK2N1 inhibits prostate cancer progression through androgen receptor-dependent signaling.
25003983 2014 The tumor suppressive role of CAMK2N1 in castration-resistant prostate cancer.
18305109 2008 A novel endogenous human CaMKII inhibitory protein suppresses tumor growth by inducing cell cycle arrest via p27 stabilization.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
12650977 2003 Autophosphorylated calcium/calmodulin-dependent protein kinase II alpha (CaMKII alpha) reversibly targets to and phosphorylates N-methyl-D-aspartate receptor subunit 2B (NR2B) in cerebral ischemia and reperfusion in hippocampus of rats.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12175859 Phosphorylation of the recombinant rho1 GABA receptor.