Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.81
PubTator Score 0.70

Knowledge Summary


No data available



  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.200 8.0e-04
Astrocytoma, Pilocytic -1.200 3.8e-05
atypical teratoid / rhabdoid tumor -2.000 9.6e-07
ependymoma -2.600 2.4e-24
glioblastoma -1.200 1.6e-04
lung carcinoma 1.300 3.2e-32
osteosarcoma 1.128 5.9e-06
ovarian cancer -1.500 6.4e-06
subependymal giant cell astrocytoma -1.779 2.6e-02


Accession Q7Z7J7 A6NH76 Q29RV7


  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

PENKDFVGSTVSSVLRPGGDVSGWGVLPCPVAHSQGP                                     211 - 247

Text Mined References (4)

PMID Year Title