Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.47
PubTator Score 0.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma 1.128 0.000
posterior fossa group A ependymoma -2.800 0.000
glioblastoma -1.700 0.000
atypical teratoid / rhabdoid tumor -2.000 0.000
pediatric high grade glioma -1.400 0.000
pilocytic astrocytoma -1.200 0.000
subependymal giant cell astrocytoma -1.779 0.026
lung carcinoma 1.300 0.000
ovarian cancer -1.500 0.000

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
15905332 The authors present an overview of the LHFP gene family in mouse and humans

AA Sequence

MLPSQEASKLYHEHYMRNSRAIGVLWAIFTICFAIINVVVFIQPYWVGDSVSTPKPGYFGLFHYCVGSGL      1 - 70
AGRELTCRGSFTDFSTIPSSAFKAAAFFVLLSMVLILGCITCFSLFFFCNTATVYKICAWMQLLAALCLV     71 - 140
LGCMIFPDGWDAETIRDMCGAKTGKYSLGDCSVRWAYILAIIGILNALILSFLAFVLGNRQTDLLQEELK    141 - 210
PENKDFVGSTVSSVLRPGGDVSGWGVLPCPVAHSQGP                                     211 - 247
//

Text Mined References (4)

PMID Year Title
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15905332 2005 A missense mutation in the previously undescribed gene Tmhs underlies deafness in hurry-scurry (hscy) mice.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.