Property Summary

NCBI Gene PubMed Count 15
Grant Count 4
R01 Count 2
Funding $1,127,416
PubMed Score 30.49
PubTator Score 14.99

Knowledge Summary

Patent

No data available

Gene RIF (8)

PMID Text
26745102 High DPPA2 Protein Expression is Associated with Gastric Cancer Metastasis
25497006 results showed that DPPA2 expression was significantly correlated to the depth of tumor invasion and progression of tumor cells through advanced stages in colorectal cancer.
24532429 A important role of HIWI and DPPA2 in tumorigenesis and also in lymph node metastasis of tumor cells.
23963736 Results identified a new family of pluripotency-related oncogenes consisting of DPPA2 and DPPA4.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19705800 In normal tissues, PLAC1 expression was restricted to the placenta while DPPA2 expression was restricted to the placenta and testis.
18519755 ECSA/DPPA2 is a promising target for antigen-specific immunotherapy in non-small cell lung cancers
18467432 Differential expression of the embryo/cancer gene ECSA(DPPA2) in human preimplantation development.

AA Sequence

MSDANLDSSKKNFLEGEVDDEESVILTLVPVKDDANMEQMEPSVSSTSDVKLEKPKKYNPGHLLQTNEQF      1 - 70
TAPQKARCKIPALPLPTILPPINKVCRDTLRDWCQQLGLSTNGKKIEVYLRLHRHAYPEQRQDMPEMSQE     71 - 140
TRLQRCSRKRKAVTKRARLQRSYEMNERAEETNTVEVITSAPGAMLASWARIAARAVQPKALNSCSIPVS    141 - 210
VEAFLMQASGVRWCVVHGRLLSADTKGWVRLQFHAGQAWVPTTHRRMISLFLLPACIFPSPGIEDNMLCP    211 - 280
DCAKRNKKMMKRLMTVEK                                                        281 - 298
//

Text Mined References (15)

PMID Year Title
26745102 2015 DPPA2 Protein Expression is Associated with Gastric Cancer Metastasis.
25497006 2015 Diagnostic clinical relevance of developmental pluripotency-associated 2 (DPPA2) in colorectal cancer.
24532429 2014 Aberrant expression of DPPA2 and HIWI genes in colorectal cancer and their impacts on poor prognosis.
23963736 2013 Identification of DPPA4 and DPPA2 as a novel family of pluripotency-related oncogenes.
23761726 2013 Interrogation of the platelet-derived growth factor receptor alpha locus and corneal astigmatism in Australians of Northern European ancestry: results of a genome-wide association study.
21896782 2011 Essential roles of ECAT15-2/Dppa2 in functional lung development.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19705800 2009 Expression and serum immunoreactivity of developmentally restricted differentiation antigens in epithelial ovarian cancer.
18519755 2008 ECSA/DPPA2 is an embryo-cancer antigen that is coexpressed with cancer-testis antigens in non-small cell lung cancer.
18467432 2008 Differential expression of the embryo/cancer gene ECSA(DPPA2), the cancer/testis gene BORIS and the pluripotency structural gene OCT4, in human preimplantation development.
More...