Property Summary

NCBI Gene PubMed Count 15
PubMed Score 29.14
PubTator Score 14.99

Knowledge Summary

Patent

No data available

Synonym

Accession Q7Z7J5 Q8WVF0
Symbols CT100
PESCRG1
ECAT15-2

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (8)

AA Sequence

MSDANLDSSKKNFLEGEVDDEESVILTLVPVKDDANMEQMEPSVSSTSDVKLEKPKKYNPGHLLQTNEQF      1 - 70
TAPQKARCKIPALPLPTILPPINKVCRDTLRDWCQQLGLSTNGKKIEVYLRLHRHAYPEQRQDMPEMSQE     71 - 140
TRLQRCSRKRKAVTKRARLQRSYEMNERAEETNTVEVITSAPGAMLASWARIAARAVQPKALNSCSIPVS    141 - 210
VEAFLMQASGVRWCVVHGRLLSADTKGWVRLQFHAGQAWVPTTHRRMISLFLLPACIFPSPGIEDNMLCP    211 - 280
DCAKRNKKMMKRLMTVEK                                                        281 - 298
//

Text Mined References (15)

PMID Year Title