Property Summary

NCBI Gene PubMed Count 30
PubMed Score 171.73
PubTator Score 53.60

Knowledge Summary


No data available


  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma -1.100 0.000
astrocytic glioma 1.500 0.014
oligodendroglioma 1.200 0.029
psoriasis -1.200 0.001
osteosarcoma 1.888 0.002
tuberculosis 1.300 0.000
intraductal papillary-mucinous adenoma (... 1.200 0.004
Pick disease 1.800 0.000
ovarian cancer -1.900 0.000



  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (20)

26104215 Novel VPS13B deletion mutations in three large Pakistani Cohen Syndrome families suggests a Baloch variant with Autistic-Like features.
25492866 Association of COH1 with the Golgi complex is mediated by its interaction with RAB6 and is required for neurite outgrowth.
25060287 This report emphasizes the value of a broad-based whole exome sequencing approach in disease gene identification in the syndromic retinal dystrophies, where all disease characteristics may not be present in young patients to allow a clinical diagnosis.
24311531 This observation emphasizes that VPS13B analysis should be performed in cases of congenital neutropenia associated with retinopathy, even in the absence of ID, therefore extending the VPS13B phenotype spectrum.
21865173 COH1 as a Golgi-associated matrix protein required for Golgi integrity.
21353197 This high frequency of causal submicroscopic chromosomal aberrations in patients with congenital ocular malformation warrants implementation of array comparative genomic hybridization in the diagnostic work-up of these patients.
20656880 VPS13B screening is not indicated in the absence of chorioretinal dystrophy or neutropenia in patients aged over 5 years.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20461111 This study confirms that COH1 copy number variations are a frequent cause of Cohen syndrome and consist of intragenic deletions as well as duplications.
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

KTYHYLVDPHFAQVFLSKFTMVKNKALRKGFP                                         3991 - 4022

Text Mined References (36)

PMID Year Title
26104215 2015 Novel VPS13B Mutations in Three Large Pakistani Cohen Syndrome Families Suggests a Baloch Variant with Autistic-Like Features.
25492866 2015 Cohen syndrome-associated protein COH1 physically and functionally interacts with the small GTPase RAB6 at the Golgi complex and directs neurite outgrowth.
25060287 2015 Value of whole exome sequencing for syndromic retinal dystrophy diagnosis in young patients.
24665060 2014 Genome-wide association study of smoking behaviours among Bangladeshi adults.
24311531 2014 Congenital neutropenia with retinopathy, a new phenotype without intellectual deficiency or obesity secondary to VPS13B mutations.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23033978 2012 Diagnostic exome sequencing in persons with severe intellectual disability.
22745009 2012 Multiple loci influencing hippocampal degeneration identified by genome scan.
21865173 2011 Cohen syndrome-associated protein, COH1, is a novel, giant Golgi matrix protein required for Golgi integrity.
21353197 2011 High frequency of submicroscopic chromosomal deletions in patients with idiopathic congenital eye malformations.