Property Summary

NCBI Gene PubMed Count 6
PubMed Score 13.96
PubTator Score 1.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Cocaine Dependence 51 3.523 1.8

Expression

AA Sequence

MAFLMKSMISNQVKNLGFGGGSEENKEEGGASDPAAAQGMTREEYEEYQKQMIEEKMERDAAFTQKKAER      1 - 70
ACLRVHLREKYRLPKSEMDENQIQMAGDDVDLPEDLRKMVDEDQEEEEDKDSILGQIQNLQNMDLDTIKE     71 - 140
KAQATFTEIKQTAEQKCSVM                                                      141 - 160
//

Text Mined References (7)

PMID Year Title