Property Summary

NCBI Gene PubMed Count 6
PubMed Score 13.99
PubTator Score 1.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Cocaine dependence 24 3.498 1.7

AA Sequence

MAFLMKSMISNQVKNLGFGGGSEENKEEGGASDPAAAQGMTREEYEEYQKQMIEEKMERDAAFTQKKAER      1 - 70
ACLRVHLREKYRLPKSEMDENQIQMAGDDVDLPEDLRKMVDEDQEEEEDKDSILGQIQNLQNMDLDTIKE     71 - 140
KAQATFTEIKQTAEQKCSVM                                                      141 - 160
//

Text Mined References (7)

PMID Year Title
21697133 2011 Full-length transcriptome analysis of human retina-derived cell lines ARPE-19 and Y79 using the vector-capping method.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15911881 2005 Structurally and functionally unique complexins at retinal ribbon synapses.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.