Property Summary

NCBI Gene PubMed Count 15
PubMed Score 11.16
PubTator Score 9.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 6.55933936163013E-24
breast carcinoma 1614 3.41200550580984E-16
ovarian cancer 8492 1.19880642935565E-12
lung carcinoma 2844 1.3615459179064E-12
lung adenocarcinoma 2714 1.14568504540209E-11
posterior fossa group A ependymoma 1511 3.64808217068799E-9
juvenile dermatomyositis 1189 6.44368204833854E-9
psoriasis 6685 3.44002016671144E-8
Breast cancer 3099 1.61768784089903E-7
Duchenne muscular dystrophy 602 3.90556805975721E-7
colon cancer 1475 1.51373435621534E-6
cystic fibrosis 1670 1.70577165718996E-6
primary pancreatic ductal adenocarcinoma 1271 6.99133511379157E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 9.22502397080808E-5
lung cancer 4473 1.08086164756789E-4
fascioscapulohumeral muscular dystrophy 100 2.0326168415797E-4
pancreatic cancer 2300 0.00132490939705587
primary Sjogren syndrome 789 0.00137895380995639
group 4 medulloblastoma 1875 0.00143287581895951
pilocytic astrocytoma 3086 0.00171865078481914
astrocytic glioma 2241 0.00346096805196157
pituitary cancer 1972 0.00549316753384575
acute quadriplegic myopathy 1157 0.00558736378893996
limb girdle muscular dystrophy 2A 156 0.00944719040830843
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.0115618446353267
fibroadenoma 557 0.0120427704213191
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0157811706418944
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0171194589062684
invasive ductal carcinoma 2950 0.0195954884414288
head and neck cancer 270 0.0214827849236137
sarcoidosis 368 0.0289294447021819
nasopharyngeal carcinoma 1056 0.0371164874415327
adult high grade glioma 2148 0.0387036400757043
spina bifida 1064 0.0408825584554193
ductal carcinoma in situ 1745 0.0412235811751804

Expression

Synonym

Accession Q7Z7G0 B3KSL4 Q6ZW20 Q6ZW22 Q9C082 Q9UFI6 Tarsh
Symbols TARSH
NESHBP

Gene

  Ortholog (8)

Species Source
Chimp EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG
Anole lizard EggNOG Inparanoid
Xenopus OMA EggNOG

 MGI Term (1)

 CSPA Cell Line (2)

Gene RIF (7)

PMID Text
24442417 ABI3BP is a susceptibility gene for Kashin-Beck disease in the Chinese Han population.
21041247 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19338757 These results suggest that TARSH plays an important role in proliferation of replicative senescence and may serve as a trigger of tumor development.
19240061 Observational study of gene-disease association. (HuGE Navigator)
18559958 The loss of ABI3BP expression could play a functional role in thyroid tumorigenesis.
16205947 expression of TARSH mRNA is remarkably downregulated in all lung cancer cell lines examined; also TARSH expression was significantly low in all of the tumor specimens when compared to the expression in corresponding non-neoplastic lung tissue specimens
15752759 Thus, TARSH presumably represents a trigger gene for evoking cellular senescence, which has also been suggested to be involved in the prevention of tumorigenesis.

AA Sequence

MRGGKCNMLSSLGCLLLCGSITLALGNAQKLPKGKRPNLKVHINTTSDSILLKFLRPSPNVKLEGLLLGY      1 - 70
GSNVSPNQYFPLPAEGKFTEAIVDAEPKYLIVVRPAPPPSQKKSCSGKTRSRKPLQLVVGTLTPSSVFLS     71 - 140
WGFLINPHHDWTLPSHCPNDRFYTIRYREKDKEKKWIFQICPATETIVENLKPNTVYEFGVKDNVEGGIW    141 - 210
SKIFNHKTVVGSKKVNGKIQSTYDQDHTVPAYVPRKLIPITIIKQVIQNVTHKDSAKSPEKAPLGGVILV    211 - 280
HLIIPGLNETTVKLPASLMFEISDALKTQLAKNETLALPAESKTPEVEKISARPTTVTPETVPRSTKPTT    281 - 350
SSALDVSETTLASSEKPWIVPTAKISEDSKVLQPQTATYDVFSSPTTSDEPEISDSYTATSDRILDSIPP    351 - 420
KTSRTLEQPRATLAPSETPFVPQKLEIFTSPEMQPTTPAPQQTTSIPSTPKRRPRPKPPRTKPERTTSAG    421 - 490
TITPKISKSPEPTWTTPAPGKTQFISLKPKIPLSPEVTHTKPAPKQTPRAPPKPKTSPRPRIPQTQPVPK    491 - 560
VPQRVTAKPKTSPSPEVSYTTPAPKDVLLPHKPYPEVSQSEPAPLETRGIPFIPMISPSPSQEELQTTLE    561 - 630
ETDQSTQEPFTTKIPRTTELAKTTQAPHRFYTTVRPRTSDKPHIRPGVKQAPRPSGADRNVSVDSTHPTK    631 - 700
KPGTRRPPLPPRPTHPRRKPLPPNNVTGKPGSAGIISSGPITTPPLRSTPRPTGTPLERIETDIKQPTVP    701 - 770
ASGEELENITDFSSSPTRETDPLGKPRFKGPHVRYIQKPDNSPCSITDSVKRFPKEEATEGNATSPPQNP    771 - 840
PTNLTVVTVEGCPSFVILDWEKPLNDTVTEYEVISRENGSFSGKNKSIQMTNQTFSTVENLKPNTSYEFQ    841 - 910
VKPKNPLGEGPVSNTVAFSTESADPRVSEPVSAGRDAIWTERPFNSDSYSECKGKQYVKRTWYKKFVGVQ    911 - 980
LCNSLRYKIYLSDSLTGKFYNIGDQRGHGEDHCQFVDSFLDGRTGQQLTSDQLPIKEGYFRAVRQEPVQF    981 - 1050
GEIGGHTQINYVQWYECGTTIPGKW                                                1051 - 1075
//

Text Mined References (17)

PMID Year Title
24442417 2014 Genome-wide copy number variation study and gene expression analysis identify ABI3BP as a susceptibility gene for Kashin-Beck disease.
24236485 2013 Genome-wide association study in NSAID-induced acute urticaria/angioedema in Spanish and Han Chinese populations.
23829686 2013 Rank-based genome-wide analysis reveals the association of ryanodine receptor-2 gene variants with childhood asthma among human populations.
21041247 2010 Genome-wide association study of suicide attempts in mood disorder patients.
20551380 2010 Proteomics characterization of extracellular space components in the human aorta.
19338757 2009 Implication of p53-dependent cellular senescence related gene, TARSH in tumor suppression.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18559958 2008 Re-expression of ABI3-binding protein suppresses thyroid tumor growth by promoting senescence and inhibiting invasion.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
More...