Property Summary

NCBI Gene PubMed Count 15
PubMed Score 11.16
PubTator Score 9.37

Knowledge Summary

Patent

No data available

Expression

Gene RIF (7)

PMID Text
24442417 ABI3BP is a susceptibility gene for Kashin-Beck disease in the Chinese Han population.
21041247 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19338757 These results suggest that TARSH plays an important role in proliferation of replicative senescence and may serve as a trigger of tumor development.
19240061 Observational study of gene-disease association. (HuGE Navigator)
18559958 The loss of ABI3BP expression could play a functional role in thyroid tumorigenesis.
16205947 expression of TARSH mRNA is remarkably downregulated in all lung cancer cell lines examined; also TARSH expression was significantly low in all of the tumor specimens when compared to the expression in corresponding non-neoplastic lung tissue specimens
15752759 Thus, TARSH presumably represents a trigger gene for evoking cellular senescence, which has also been suggested to be involved in the prevention of tumorigenesis.

AA Sequence

MRGGKCNMLSSLGCLLLCGSITLALGNAQKLPKGKRPNLKVHINTTSDSILLKFLRPSPNVKLEGLLLGY      1 - 70
GSNVSPNQYFPLPAEGKFTEAIVDAEPKYLIVVRPAPPPSQKKSCSGKTRSRKPLQLVVGTLTPSSVFLS     71 - 140
WGFLINPHHDWTLPSHCPNDRFYTIRYREKDKEKKWIFQICPATETIVENLKPNTVYEFGVKDNVEGGIW    141 - 210
SKIFNHKTVVGSKKVNGKIQSTYDQDHTVPAYVPRKLIPITIIKQVIQNVTHKDSAKSPEKAPLGGVILV    211 - 280
HLIIPGLNETTVKLPASLMFEISDALKTQLAKNETLALPAESKTPEVEKISARPTTVTPETVPRSTKPTT    281 - 350
SSALDVSETTLASSEKPWIVPTAKISEDSKVLQPQTATYDVFSSPTTSDEPEISDSYTATSDRILDSIPP    351 - 420
KTSRTLEQPRATLAPSETPFVPQKLEIFTSPEMQPTTPAPQQTTSIPSTPKRRPRPKPPRTKPERTTSAG    421 - 490
TITPKISKSPEPTWTTPAPGKTQFISLKPKIPLSPEVTHTKPAPKQTPRAPPKPKTSPRPRIPQTQPVPK    491 - 560
VPQRVTAKPKTSPSPEVSYTTPAPKDVLLPHKPYPEVSQSEPAPLETRGIPFIPMISPSPSQEELQTTLE    561 - 630
ETDQSTQEPFTTKIPRTTELAKTTQAPHRFYTTVRPRTSDKPHIRPGVKQAPRPSGADRNVSVDSTHPTK    631 - 700
KPGTRRPPLPPRPTHPRRKPLPPNNVTGKPGSAGIISSGPITTPPLRSTPRPTGTPLERIETDIKQPTVP    701 - 770
ASGEELENITDFSSSPTRETDPLGKPRFKGPHVRYIQKPDNSPCSITDSVKRFPKEEATEGNATSPPQNP    771 - 840
PTNLTVVTVEGCPSFVILDWEKPLNDTVTEYEVISRENGSFSGKNKSIQMTNQTFSTVENLKPNTSYEFQ    841 - 910
VKPKNPLGEGPVSNTVAFSTESADPRVSEPVSAGRDAIWTERPFNSDSYSECKGKQYVKRTWYKKFVGVQ    911 - 980
LCNSLRYKIYLSDSLTGKFYNIGDQRGHGEDHCQFVDSFLDGRTGQQLTSDQLPIKEGYFRAVRQEPVQF    981 - 1050
GEIGGHTQINYVQWYECGTTIPGKW                                                1051 - 1075
//

Text Mined References (17)

PMID Year Title
24442417 2014 Genome-wide copy number variation study and gene expression analysis identify ABI3BP as a susceptibility gene for Kashin-Beck disease.
24236485 2013 Genome-wide association study in NSAID-induced acute urticaria/angioedema in Spanish and Han Chinese populations.
23829686 2013 Rank-based genome-wide analysis reveals the association of ryanodine receptor-2 gene variants with childhood asthma among human populations.
21041247 2010 Genome-wide association study of suicide attempts in mood disorder patients.
20551380 2010 Proteomics characterization of extracellular space components in the human aorta.
19338757 2009 Implication of p53-dependent cellular senescence related gene, TARSH in tumor suppression.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18559958 2008 Re-expression of ABI3-binding protein suppresses thyroid tumor growth by promoting senescence and inhibiting invasion.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
More...