Property Summary

NCBI Gene PubMed Count 17
PubMed Score 12.39
PubTator Score 9.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Endometriosis 540 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.5

Expression

  Differential Expression (35)

Disease log2 FC p
acute quadriplegic myopathy 1.338 5.6e-03
adult high grade glioma 1.500 3.9e-02
astrocytic glioma 2.500 3.5e-03
Astrocytoma, Pilocytic 1.800 1.1e-03
autosomal dominant Emery-Dreifuss muscul... 1.788 1.2e-02
Breast cancer -2.100 1.6e-07
breast carcinoma -1.600 3.4e-16
colon cancer -2.000 1.5e-06
cystic fibrosis 2.442 1.7e-06
Duchenne muscular dystrophy 2.161 3.9e-07
ductal carcinoma in situ -1.200 4.1e-02
ependymoma 1.600 1.5e-02
fascioscapulohumeral muscular dystrophy 1.293 2.0e-04
fibroadenoma -1.300 1.2e-02
group 4 medulloblastoma -1.600 1.4e-03
head and neck cancer -1.600 2.1e-02
intraductal papillary-mucinous adenoma (... -2.400 1.7e-02
intraductal papillary-mucinous carcinoma... -1.500 2.0e-02
intraductal papillary-mucinous neoplasm ... -3.500 1.6e-02
invasive ductal carcinoma -2.800 2.0e-02
juvenile dermatomyositis 1.923 6.4e-09
limb girdle muscular dystrophy 2A 1.411 9.4e-03
lung adenocarcinoma -1.900 1.1e-11
lung cancer -2.600 1.1e-04
lung carcinoma -2.900 1.4e-12
nasopharyngeal carcinoma -1.800 3.7e-02
non-small cell lung cancer -3.290 6.6e-24
ovarian cancer -2.400 1.3e-12
pancreatic cancer 2.500 1.3e-03
pituitary cancer -1.700 5.5e-03
primary pancreatic ductal adenocarcinoma 2.825 7.0e-05
primary Sjogren syndrome 1.300 1.4e-03
psoriasis -1.100 3.4e-08
sarcoidosis 1.300 2.9e-02
spina bifida -1.275 4.1e-02

 MGI Phenotype (1)

 CSPA Cell Line (2)

Gene RIF (7)

AA Sequence

MRGGKCNMLSSLGCLLLCGSITLALGNAQKLPKGKRPNLKVHINTTSDSILLKFLRPSPNVKLEGLLLGY      1 - 70
GSNVSPNQYFPLPAEGKFTEAIVDAEPKYLIVVRPAPPPSQKKSCSGKTRSRKPLQLVVGTLTPSSVFLS     71 - 140
WGFLINPHHDWTLPSHCPNDRFYTIRYREKDKEKKWIFQICPATETIVENLKPNTVYEFGVKDNVEGGIW    141 - 210
SKIFNHKTVVGSKKVNGKIQSTYDQDHTVPAYVPRKLIPITIIKQVIQNVTHKDSAKSPEKAPLGGVILV    211 - 280
HLIIPGLNETTVKLPASLMFEISDALKTQLAKNETLALPAESKTPEVEKISARPTTVTPETVPRSTKPTT    281 - 350
SSALDVSETTLASSEKPWIVPTAKISEDSKVLQPQTATYDVFSSPTTSDEPEISDSYTATSDRILDSIPP    351 - 420
KTSRTLEQPRATLAPSETPFVPQKLEIFTSPEMQPTTPAPQQTTSIPSTPKRRPRPKPPRTKPERTTSAG    421 - 490
TITPKISKSPEPTWTTPAPGKTQFISLKPKIPLSPEVTHTKPAPKQTPRAPPKPKTSPRPRIPQTQPVPK    491 - 560
VPQRVTAKPKTSPSPEVSYTTPAPKDVLLPHKPYPEVSQSEPAPLETRGIPFIPMISPSPSQEELQTTLE    561 - 630
ETDQSTQEPFTTKIPRTTELAKTTQAPHRFYTTVRPRTSDKPHIRPGVKQAPRPSGADRNVSVDSTHPTK    631 - 700
KPGTRRPPLPPRPTHPRRKPLPPNNVTGKPGSAGIISSGPITTPPLRSTPRPTGTPLERIETDIKQPTVP    701 - 770
ASGEELENITDFSSSPTRETDPLGKPRFKGPHVRYIQKPDNSPCSITDSVKRFPKEEATEGNATSPPQNP    771 - 840
PTNLTVVTVEGCPSFVILDWEKPLNDTVTEYEVISRENGSFSGKNKSIQMTNQTFSTVENLKPNTSYEFQ    841 - 910
VKPKNPLGEGPVSNTVAFSTESADPRVSEPVSAGRDAIWTERPFNSDSYSECKGKQYVKRTWYKKFVGVQ    911 - 980
LCNSLRYKIYLSDSLTGKFYNIGDQRGHGEDHCQFVDSFLDGRTGQQLTSDQLPIKEGYFRAVRQEPVQF    981 - 1050
GEIGGHTQINYVQWYECGTTIPGKW                                                1051 - 1075
//

Text Mined References (20)

PMID Year Title