Property Summary

NCBI Gene PubMed Count 16
PubMed Score 14.83
PubTator Score 8.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 7.0e-08
osteosarcoma 7950 5.5e-06
Multiple myeloma 1332 4.9e-04
non primary Sjogren syndrome sicca 891 4.1e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (4)

Disease log2 FC p
Multiple myeloma 1.569 4.9e-04
non primary Sjogren syndrome sicca 1.300 4.1e-02
osteosarcoma -1.656 5.5e-06
ovarian cancer -1.200 7.0e-08

Gene RIF (6)

AA Sequence

MQQPQPQGQQQPGPGQQLGGQGAAPGAGGGPGGGPGPGPCLRRELKLLESIFHRGHERFRIASACLDELS      1 - 70
CEFLLAGAGGAGAGAAPGPHLPPRGSVPGDPVRIHCNITESYPAVPPIWSVESDDPNLAAVLERLVDIKK     71 - 140
GNTLLLQHLKRIISDLCKLYNLPQHPDVEMLDQPLPAEQCTQEDVSSEDEDEEMPEDTEDLDHYEMKEEE    141 - 210
PAEGKKSEDDGIGKENLAILEKIKKNQRQDYLNGAVSGSVQATDRLMKELRDIYRSQSFKGGNYAVELVN    211 - 280
DSLYDWNVKLLKVDQDSALHNDLQILKEKEGADFILLNFSFKDNFPFDPPFVRVVSPVLSGGYVLGGGAI    281 - 350
CMELLTKQGWSSAYSIESVIMQISATLVKGKARVQFGANKSQYSLTRAQQSYKSLVQIHEKNGWYTPPKE    351 - 420
DG                                                                        421 - 422
//

Text Mined References (20)

PMID Year Title