Property Summary

NCBI Gene PubMed Count 16
PubMed Score 10.33
PubTator Score 8.27

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
Multiple myeloma 1.569 0.000
osteosarcoma -1.656 0.000
non primary Sjogren syndrome sicca 1.300 0.041
ovarian cancer 2.200 0.000

Synonym

Accession Q7Z7E8 B4DF92 Q29SN7 Q3B841 Q5I0X2 Q6IS04 Q6P7P2 Q96MV4 Q9BVX5 Q9UGL6
Symbols GTAP
UBE2Q
NICE-5
PRO3094

Gene

PANTHER Protein Class (1)

PDB

2QGX  

Gene RIF (6)

PMID Text
26745068 UBE2Q1 hypermethylation is associated with Colorectal Cancer.
25987028 overexpression of UBE2Q1 is associated with Breast Carcinoma.
25311764 These data imply that UBE2Q1 is upregulated in liver cancer cell lines and tumorous samples and may play a role in the development of HCC.
24197692 UBE2Q1 is differentially expressed in colorectal cell lines and shows overexpression in colorectal tumors.
22167327 This result along with the real-time PCR data shows that the novel human gene, UBE2Q1, is expressed in human breast and may have implications for pathogenesis of breast cancer.
22124266 we found somatic mutations of HERC2, HERC3, TRIP12, UBE2Q1 and UBE4B genes in gastric carcinoma and colorectal carcinomas with microsatellite instability

AA Sequence

MQQPQPQGQQQPGPGQQLGGQGAAPGAGGGPGGGPGPGPCLRRELKLLESIFHRGHERFRIASACLDELS      1 - 70
CEFLLAGAGGAGAGAAPGPHLPPRGSVPGDPVRIHCNITESYPAVPPIWSVESDDPNLAAVLERLVDIKK     71 - 140
GNTLLLQHLKRIISDLCKLYNLPQHPDVEMLDQPLPAEQCTQEDVSSEDEDEEMPEDTEDLDHYEMKEEE    141 - 210
PAEGKKSEDDGIGKENLAILEKIKKNQRQDYLNGAVSGSVQATDRLMKELRDIYRSQSFKGGNYAVELVN    211 - 280
DSLYDWNVKLLKVDQDSALHNDLQILKEKEGADFILLNFSFKDNFPFDPPFVRVVSPVLSGGYVLGGGAI    281 - 350
CMELLTKQGWSSAYSIESVIMQISATLVKGKARVQFGANKSQYSLTRAQQSYKSLVQIHEKNGWYTPPKE    351 - 420
DG                                                                        421 - 422
//

Text Mined References (19)

PMID Year Title
26745068 2015 Promoter Methylation Status of Two Novel Human Genes, UBE2Q1 and UBE2Q2, in Colorectal Cancer: a New Finding in Iranian Patients.
25987028 2015 UBE2Q1 in a Human Breast Carcinoma Cell Line: Overexpression and Interaction with p53.
25416956 2014 A proteome-scale map of the human interactome network.
25340798 2014 Genome-wide association study of CSF levels of 59 alzheimer's disease candidate proteins: significant associations with proteins involved in amyloid processing and inflammation.
25311764 2015 Upregulated expression of ubiquitin-conjugating enzyme E2Q1 (UBE2Q1) is associated with enhanced cell proliferation and poor prognosis in human hapatocellular carcinoma.
24197692 2013 UBE2Q1 expression in human colorectal tumors and cell lines.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22167327 2012 Expression of the novel human gene, UBE2Q1, in breast tumors.
22124266 2011 Frameshift mutations of ubiquitination-related genes HERC2, HERC3, TRIP12, UBE2Q1 and UBE4B in gastric and colorectal carcinomas with microsatellite instability.
21269460 2011 Initial characterization of the human central proteome.
More...