Property Summary

NCBI Gene PubMed Count 75
Grant Count 100
R01 Count 63
Funding $7,720,450.77
PubMed Score 156.29
PubTator Score 108.05

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q7Z7D3 Q0GN76 Q45VN0 Q5WPZ3 Q6P097 Q9H6B2
Symbols B7X
B7H4
B7S1
B7-H4
B7h.5
VCTN1
PRO1291

Gene

PDB

4GOS  

Gene RIF (68)

PMID Text
26773144 Data show that disrupted control of costimulation, evidenced by VTCN1 loss in both APCs and pancreatic islets, ultimately results in altered balance of control of immune responses.
26505457 study suggest that serum B7-H4 is an independent prognostic indicator for HCC and may be a promising biomarker for early diagnosis as well as disease prognosis of HCC.
26301886 Data indicate that the diagnostic efficiency of V-set domain containing T cell activation inhibitor 1 (sB7-H4) combined carcinoembryonic antigen (CEA) was superior to either sB7-H4 or CEA.
26211593 Low expression of VTCN1 inhibits the viability and metastasis of ovarian carcinoma.
26101181 In human amniotic fluid stem cells, the negative co-stimulatory molecule B7H4 regulates low immunogenicity, which can provide a modest inflammatory reaction microenvironment for wound repair.
26078947 B7-H4 expressed is elevated in colorectal cancer tissues than in the adjacent normal tissues. B7-H4 siRNA effectively inhibited the proliferation at 24 h and 48 h, arrested cell cycle at G0/G1, and suppressed cell invasion and migration.
25963168 B7-H4 levels in hepatocellular carcinoma patients were significantly higher than that in healthy controls. High B7-H4 levels were correlated with tumor size, tumor invasion, tumor differentiation and tumor-node metastasis stage.
25954746 our data suggest that the evaluation of B7-H4 expression in tissues and blood is a useful tool for predicting the progression of osteosarcoma and prognosis
25907449 In women who underwent elective cesarian section, a significant increase in sB7-H4 serum levels occurred postpartal, while in women who experienced spontaneous onset of labor, there were no differences between prepartal and postpartal levels.
25725157 Chromatin immunoprecipitation analysis demonstrated binding of hypoxia-inducible factor-1alpha (HIF-1alpha) to proximal hypoxia-response element (HRE) sites within the B7-H4 promoter in multiple myeloma cells and cancer cell lines.
More...

AA Sequence

MASLGQILFWSIISIIIILAGAIALIIGFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQ      1 - 70
WLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGN     71 - 140
ANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKV    141 - 210
VSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKASLCVSSFFAISWALLPLSPYLM    211 - 280
LK                                                                        281 - 282
//

Text Mined References (79)

PMID Year Title
26773144 2016 Loss of Peripheral Protection in Pancreatic Islets by Proteolysis-Driven Impairment of VTCN1 (B7-H4) Presentation Is Associated with the Development of Autoimmune Diabetes.
26505457 2015 Circulating B7-H4 in serum predicts prognosis in patients with hepatocellular carcinoma.
26301886 2015 Evaluation of serum and pleural levels of soluble B7-H4 in lung cancer patients with pleural effusion.
26211593 2015 Effect of VTCN1 on progression and metastasis of ovarian carcinoma in vitro and vivo.
26101181 2015 Amniotic fluid stem cells provide considerable advantages in epidermal regeneration: B7H4 creates a moderate inflammation microenvironment to promote wound repair.
26078947 2015 Role of B7-H4 siRNA in Proliferation, Migration, and Invasion of LOVO Colorectal Carcinoma Cell Line.
25963168 2015 Diagnostic value of serum B7-H4 for hepatocellular carcinoma.
25954746 2015 B7-H4 expression is associated with tumor progression and prognosis in patients with osteosarcoma.
25907449 2015 Changes in the Blood Serum Levels of the Costimulatory Soluble B7-H4 Molecule in Pregnant Women During the Peripartal Phase.
25725157 2015 Cancer cell-associated cytoplasmic B7-H4 is induced by hypoxia through hypoxia-inducible factor-1? and promotes cancer cell proliferation.
More...