Property Summary

NCBI Gene PubMed Count 99
PubMed Score 178.53
PubTator Score 108.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Breast cancer -2.500 2.5e-04
ductal carcinoma in situ 2.000 4.3e-02
Endometriosis -1.306 2.8e-02
interstitial cystitis -1.700 2.4e-02
intraductal papillary-mucinous adenoma (... -1.800 1.0e-02
intraductal papillary-mucinous carcinoma... -2.200 3.9e-04
medulloblastoma, large-cell 1.200 2.7e-04
non-small cell lung cancer 1.637 9.0e-08
ovarian cancer 2.800 5.7e-04
pancreatic cancer -1.300 1.7e-02
primary pancreatic ductal adenocarcinoma -1.249 3.7e-02
psoriasis -1.200 1.8e-17

Gene RIF (92)

AA Sequence

MASLGQILFWSIISIIIILAGAIALIIGFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQ      1 - 70
WLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGN     71 - 140
ANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKV    141 - 210
VSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKASLCVSSFFAISWALLPLSPYLM    211 - 280
LK                                                                        281 - 282
//

Text Mined References (103)

PMID Year Title