Property Summary

NCBI Gene PubMed Count 12
PubMed Score 88.78
PubTator Score 18.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

Gene RIF (4)

AA Sequence

MGKIDVDKILFFNQEIRLWQLIMATPEENSNPHDRATPQLPAQLQELEHRVARRRLSQARHRATLAALFN      1 - 70
NLRKTVYSQSDLIASKWQVLNKAKSHIPELEQTLDNLLKLKASFNLEDGHASSLEEVKKEYASMYSGNDS     71 - 140
FPQNGSSPWYLNFYKQTMDLLTGSGIITPQEAALPIVSAAISHLWQNLSEERKASLRQAWAQKHRGPATL    141 - 210
AEACREPACAEGSVKDSGVDSQGASCSLVSTPEEILFEDAFDVASFLDKSEVPSTSSSSSVLASCNPENP    211 - 280
EEKFQLYMQIINFFKGLSCANTQVKQEASFPVDEEMIMLQCTETFDDEDL                        281 - 330
//

Text Mined References (13)

PMID Year Title