Property Summary

NCBI Gene PubMed Count 11
Grant Count 24
R01 Count 6
Funding $12,054,817.5
PubMed Score 80.41
PubTator Score 18.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

Gene RIF (4)

PMID Text
23320086 The genetic variant rs10269148 of STRA8 gene shows higher risk of spermatogenic impairment in the groups of abnormospermia than the controls
20378615 Observational study of gene-disease association. (HuGE Navigator)
18799751 Functional characterization of an homologous mouse gene.
12489526 Expression restricted to testis (STRA8)

AA Sequence

MGKIDVDKILFFNQEIRLWQLIMATPEENSNPHDRATPQLPAQLQELEHRVARRRLSQARHRATLAALFN      1 - 70
NLRKTVYSQSDLIASKWQVLNKAKSHIPELEQTLDNLLKLKASFNLEDGHASSLEEVKKEYASMYSGNDS     71 - 140
FPQNGSSPWYLNFYKQTMDLLTGSGIITPQEAALPIVSAAISHLWQNLSEERKASLRQAWAQKHRGPATL    141 - 210
AEACREPACAEGSVKDSGVDSQGASCSLVSTPEEILFEDAFDVASFLDKSEVPSTSSSSSVLASCNPENP    211 - 280
EEKFQLYMQIINFFKGLSCANTQVKQEASFPVDEEMIMLQCTETFDDEDL                        281 - 330
//

Text Mined References (12)

PMID Year Title
26742488 2016 Implementation of meiosis prophase I programme requires a conserved retinoid-independent stabilizer of meiotic transcripts.
23320086 2013 Genetic variants in meiotic program initiation pathway genes are associated with spermatogenic impairment in a Han Chinese population.
22899867 2012 Analysis of meiosis regulators in human gonads: a sexually dimorphic spatio-temporal expression pattern suggests involvement of DMRT1 in meiotic entry.
20670969 2010 Meiosis initiation in the human ovary requires intrinsic retinoic acid synthesis.
20378615 2010 Evaluation of 172 candidate polymorphisms for association with oligozoospermia or azoospermia in a large cohort of men of European descent.
20088251 2009 [Genetics and male infertility].
19734913 2009 Xeno-free culture of human spermatogonial stem cells supported by human embryonic stem cell-derived fibroblast-like cells.
19369649 2009 Global gene expression in the human fetal testis and ovary.
18799751 2008 Stra8 and its inducer, retinoic acid, regulate meiotic initiation in both spermatogenesis and oogenesis in mice.
18316326 2008 Exploration of human ORFeome: high-throughput preparation of ORF clones and efficient characterization of their protein products.
More...