Property Summary

NCBI Gene PubMed Count 6
PubMed Score 14.24
PubTator Score 5.26

Knowledge Summary

Patent

No data available

Synonym

Accession Q7Z7B1 Q8N9G3 PIG-W
Symbols Gwt1
HPMRS5

Gene

PANTHER Protein Class (2)

AA Sequence

MSEKQMKEAFVSNLNGTTVLEITQGLCFPAFCILCRGFLIIFSQYLCSFSPTWKTRFLTDFVVLIVPMVA      1 - 70
TLTIWASFILLELLGVIIFGAGLLYQIYRRRTCYARLPFLKILEKFLNISLESEYNPAISCFRVITSAFT     71 - 140
AIAILAVDFPLFPRRFAKTELYGTGAMDFGVGGFVFGSAMVCLEVRRRKYMEGSKLHYFTNSLYSVWPLV    141 - 210
FLGIGRLAIIKSIGYQEHLTEYGVHWNFFFTIIVVKLITPLLLIIFPLNKSWIIALGITVLYQLALDFTS    211 - 280
LKRLILYGTDGSGTRVGLLNANREGIISTLGYVAIHMAGVQTGLYMHKNRSHIKDLIKVACFLLLAAISL    281 - 350
FISLYVVQVNVEAVSRRMANLAFCIWIVASSLILLSSLLLGDIILSFAKFLIKGALVPCSWKLIQSPVTN    351 - 420
KKHSESLVPEAERMEPSLCLITALNRKQLIFFLLSNITTGLINLMVDTLHSSTLWALFVVNLYMFSNCLI    421 - 490
VYVLYLQDKTVQFW                                                            491 - 504
//

Text Mined References (7)

PMID Year Title
27626616 2016 A novel mutation in PIGW causes glycosylphosphatidylinositol deficiency without hyperphosphatasia.
24367057 2014 Glycosylphosphatidylinositol (GPI) anchor deficiency caused by mutations in PIGW is associated with West syndrome and hyperphosphatasia with mental retardation syndrome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14517336 2003 PIG-W is critical for inositol acylation but not for flipping of glycosylphosphatidylinositol-anchor.
12714589 2003 GWT1 gene is required for inositol acylation of glycosylphosphatidylinositol anchors in yeast.
11102867 2000 Dissecting and manipulating the pathway for glycosylphos-phatidylinositol-anchor biosynthesis.