Property Summary

NCBI Gene PubMed Count 11
PubMed Score 5.64
PubTator Score 19.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
astrocytic glioma -1.600 1.7e-02
osteosarcoma 1.190 3.1e-03
posterior fossa group B ependymoma 1.800 4.0e-05
atypical teratoid / rhabdoid tumor -2.000 2.4e-04
glioblastoma -1.500 1.6e-02
medulloblastoma -1.500 1.4e-02
medulloblastoma, large-cell -2.400 9.8e-04
Amyotrophic Lateral Sclerosis 1.002 1.5e-04
Atopic dermatitis -1.300 3.9e-03
non-small cell lung cancer -2.470 2.1e-21
intraductal papillary-mucinous adenoma (... -1.700 5.5e-03
intraductal papillary-mucinous carcinoma... -1.600 9.0e-03
intraductal papillary-mucinous neoplasm ... -1.700 3.5e-02
lung adenocarcinoma -2.300 9.3e-12
non primary Sjogren syndrome sicca -1.100 1.5e-02
lung carcinoma -1.800 4.7e-22
ductal carcinoma in situ -1.300 8.9e-03
invasive ductal carcinoma -1.900 5.7e-03
ovarian cancer 1.600 3.2e-03
pituitary cancer 1.200 1.9e-04
psoriasis -1.100 4.7e-25

Gene RIF (2)

PMID Text
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of filamin A interacting protein 1 (FILIP1) in primary human brain microvascular endothelial cells
23087206 Data show that RhoD binds the actin nucleation-promoting factor WHAMM (WASp homologue associated with actin Golgi membranes and microtubules), as well as the related filamin A-binding protein FILIP1.

AA Sequence

MRSRNQGGESASDGHISCPKPSIIGNAGEKSLSEDAKKKKKSNRKEDDVMASGTVKRHLKTSGECERKTK      1 - 70
KSLELSKEDLIQLLSIMEGELQAREDVIHMLKTEKTKPEVLEAHYGSAEPEKVLRVLHRDAILAQEKSIG     71 - 140
EDVYEKPISELDRLEEKQKETYRRMLEQLLLAEKCHRRTVYELENEKHKHTDYMNKSDDFTNLLEQERER    141 - 210
LKKLLEQEKAYQARKEKENAKRLNKLRDELVKLKSFALMLVDERQMHIEQLGLQSQKVQDLTQKLREEEE    211 - 280
KLKAITSKSKEDRQKLLKLEVDFEHKASRFSQEHEEMNAKLANQESHNRQLRLKLVGLTQRIEELEETNK    281 - 350
NLQKAEEELQELRDKIAKGECGNSSLMAEVENLRKRVLEMEGKDEEITKTESQCRELRKKLQEEEHHSKE    351 - 420
LRLEVEKLQKRMSELEKLEEAFSKSKSECTQLHLNLEKEKNLTKDLLNELEVVKSRVKELECSESRLEKA    421 - 490
ELSLKDDLTKLKSFTVMLVDERKNMMEKIKQEERKVDGLNKNFKVEQGKVMDVTEKLIEESKKLLKLKSE    491 - 560
MEEKVYNLTRERDELIGKLKSEEEKSSELSCSVDLLKKRLDGIEEVEREITRGRSRKGSELTCPEDNKIK    561 - 630
ELTLEIERLKKRLQQLEVVEGDLMKTEDEYDQLEQKFRTEQDKANFLSQQLEEIKHQIAKNKAIEKGEVV    631 - 700
SQEAELRHRFRLEEAKSRDLKAEVQALKEKIHELMNKEDQLSQLQVDYSVLQQRFMEEENKNKNMGQEVL    701 - 770
NLTKELELSKRYSRALRPSVNGRRMVDVPVTSTGVQTDAVSGEAAEEETPAVFIRKSFQEENHIMSNLRQ    771 - 840
VGLKKPVERSSVLDRYPPAANELTMRKSWIPWMRKRENGPSITQEKGPRTNSSPGHPGEVVLSPKQGQPL    841 - 910
HIRVTPDHENSTATLEITSPTSEEFFSSTTVIPTLGNQKPRITIIPSPNVMPQKQKSGDTTLGPERAMSP    911 - 980
VTITTFSREKTPESGRGAFADRPTSPIQIMTVSTSAAPAEIAVSPESQEMPMGRTILKVTPEKQTVPTPV    981 - 1050
RKYNSNANIITTEDNKIHIHLGSQFKRSPGTSGEGVSPVITVRPVNVTAEKEVSTGTVLRSPRNHLSSRP   1051 - 1120
GASKVTSTITITPVTTSSARGTQSVSGQDGSSQRPTPTRIPMSKGMKAGKPVVAAPGAGNLTKFEPRAET   1121 - 1190
QSMKIELKKSAASSTTSLGGGKG                                                  1191 - 1213
//

Text Mined References (13)

PMID Year Title
23087206 2012 RhoD regulates cytoskeletal dynamics via the actin nucleation-promoting factor WASp homologue associated with actin Golgi membranes and microtubules.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12055638 2002 Filamin A-interacting protein (FILIP) regulates cortical cell migration out of the ventricular zone.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10574462 1999 Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.