Property Summary

NCBI Gene PubMed Count 24
Grant Count 4
Funding $166,713
PubMed Score 15.54
PubTator Score 12.83

Knowledge Summary

Patent (1,344)

Expression

Gene RIF (17)

PMID Text
25852190 Two of these kinases that were classified as resistors were PX domain-containing serine/threonine kinase (PXK) and AP2-associated kinase 1 (AAK1), which promote receptor endocytosis and may enable cells to resist TRAIL-induced apoptosis
25596907 genetic association study in Han population in China: Data suggest an SNP in PXK [rs2176082(C/T); but not rs6445975(G/T)] is associated with recurrent pregnancy loss; SNPs in KIAA0319L [rs2275247(A/G)] or JAZF1 [rs1635852(C/T)] are not associated.
24534757 Results confirm the genetic association of the locus 3p14.3 with systemic lupus erythematosus in Europeans and point to the ABHD6 and not PXK, as the major susceptibility gene in the region.
23740937 study determined that the previously described systemic lupus erythematosus susceptibility loci PXK (P = 3.27 x 10(-11), OR = 1.20) and JAZF1 (P = 1.11 x 10(-8), OR = 1.13) are shared with systemic sclerosis
22592861 The rs6445975 polymorphism of PXK and the rs2304256 polymorphism of tyrosine kinase 2 are associated with the development of systemic lupus erythematosus in Europeans
21243490 The association of PXK rs6445975 with systemic lupus erythematosus that was previously observed in Caucasians was not replicated in Koreans or in Hong Kong Chinese.
20962850 Observational study of gene-disease association. (HuGE Navigator)
20881011 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20848568 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20829310 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MAFMEKPPAGKVLLDDTVPLTAAIEASQSLQSHTEYIIRVQRGISVENSWQIVRRYSDFDLLNNSLQIAG      1 - 70
LSLPLPPKKLIGNMDREFIAERQKGLQNYLNVITTNHILSNCELVKKFLDPNNYSANYTEIALQQVSMFF     71 - 140
RSEPKWEVVEPLKDIGWRIRKKYFLMKIKNQPKERLVLSWADLGPDKYLSDKDFQCLIKLLPSCLHPYIY    141 - 210
RVTFATANESSALLIRMFNEKGTLKDLIYKAKPKDPFLKKYCNPKKIQGLELQQIKTYGRQILEVLKFLH    211 - 280
DKGFPYGHLHASNVMLDGDTCRLLDLENSLLGLPSFYRSYFSQFRKINTLESVDVHCFGHLLYEMTYGRP    281 - 350
PDSVPVDSFPPAPSMAVVAVLESTLSCEACKNGMPTISRLLQMPLFSDVLLTTSEKPQFKIPTKLKEALR    351 - 420
IAKECIEKRLIEEQKQIHQHRRLTRAQSHHGSEEERKKRKILARKKSKRSALENSEEHSAKYSNSNNSAG    421 - 490
SGASSPLTSPSSPTPPSTSGISALPPPPPPPPPPAAPLPPASTEAPAQLSSQAVNGMSRGALLSSIQNFQ    491 - 560
KGTLRKAKTCDHSAPKIG                                                        561 - 578
//

Text Mined References (27)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25596907 2015 Association between KIAA0319L, PXK and JAZF1 gene polymorphisms and unexplained recurrent pregnancy loss in Chinese Han couples.
24534757 2015 PXK locus in systemic lupus erythematosus: fine mapping and functional analysis reveals novel susceptibility gene ABHD6.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23740937 2013 A systemic sclerosis and systemic lupus erythematosus pan-meta-GWAS reveals new shared susceptibility loci.
22592861 2012 Associations between PXK and TYK2 polymorphisms and systemic lupus erythematosus: a meta-analysis.
21243490 2012 Different genetic effect of PXK on systemic lupus erythematosus in the Korean population.
20962850 2011 A targeted association study in systemic lupus erythematosus identifies multiple susceptibility alleles.
More...