Property Summary

NCBI Gene PubMed Count 25
PubMed Score 17.73
PubTator Score 12.83

Knowledge Summary

Patent (1,344)

Expression

  Differential Expression (13)

Disease log2 FC p
Rheumatoid arthritis 1.900 2.4e-02
adult high grade glioma -1.200 4.1e-03
atypical teratoid / rhabdoid tumor -1.200 3.6e-03
ependymoma -1.200 1.3e-05
invasive ductal carcinoma -1.200 9.7e-03
lung adenocarcinoma -1.100 2.0e-11
medulloblastoma, large-cell -1.900 2.0e-04
osteosarcoma 1.050 1.1e-02
ovarian cancer -1.100 3.1e-06
Pick disease -2.300 1.6e-04
progressive supranuclear palsy -2.200 9.3e-03
sonic hedgehog group medulloblastoma -1.600 1.3e-03
subependymal giant cell astrocytoma -1.798 2.9e-02

Gene RIF (18)

AA Sequence

MAFMEKPPAGKVLLDDTVPLTAAIEASQSLQSHTEYIIRVQRGISVENSWQIVRRYSDFDLLNNSLQIAG      1 - 70
LSLPLPPKKLIGNMDREFIAERQKGLQNYLNVITTNHILSNCELVKKFLDPNNYSANYTEIALQQVSMFF     71 - 140
RSEPKWEVVEPLKDIGWRIRKKYFLMKIKNQPKERLVLSWADLGPDKYLSDKDFQCLIKLLPSCLHPYIY    141 - 210
RVTFATANESSALLIRMFNEKGTLKDLIYKAKPKDPFLKKYCNPKKIQGLELQQIKTYGRQILEVLKFLH    211 - 280
DKGFPYGHLHASNVMLDGDTCRLLDLENSLLGLPSFYRSYFSQFRKINTLESVDVHCFGHLLYEMTYGRP    281 - 350
PDSVPVDSFPPAPSMAVVAVLESTLSCEACKNGMPTISRLLQMPLFSDVLLTTSEKPQFKIPTKLKEALR    351 - 420
IAKECIEKRLIEEQKQIHQHRRLTRAQSHHGSEEERKKRKILARKKSKRSALENSEEHSAKYSNSNNSAG    421 - 490
SGASSPLTSPSSPTPPSTSGISALPPPPPPPPPPAAPLPPASTEAPAQLSSQAVNGMSRGALLSSIQNFQ    491 - 560
KGTLRKAKTCDHSAPKIG                                                        561 - 578
//

Text Mined References (28)

PMID Year Title