Property Summary

NCBI Gene PubMed Count 7
PubMed Score 24.76
PubTator Score 25.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Atopic dermatitis 944
psoriasis 6,685

Expression

  Differential Expression (2)

Disease log2 FC p
Atopic dermatitis -1.400 0.004
psoriasis -3.600 0.000

Gene RIF (1)

PMID Text
16117782 Epithelial keratin, K1b, is exclusively expressed in luminal duct cells of eccrine sweat glands.

AA Sequence

MSHQFSSQSAFSSMSRRVYSTSSSAGSGGGSPAVGSVCYARGRCGGGGYGIHGRGFGSRSLYNLGGSRSI      1 - 70
SINLMGRSTSGFCQGGGVGGFGGGRGFGVGSTGAGGFGGGGFGGAGFGTSNFGLGGFGPYCPPGGIQEVT     71 - 140
INQSLLEPLHLEVDPEIQRIKTQEREQIMVLNNKFASFIDKVRFLEQQNQVLQTKWELLQQVNTSTGTNN    141 - 210
LEPLLENYIGDLRRQVDLLSAEQMRQNAEVRSMQDVVEDYKSKYEDEINKRTGSENDFVVLKKDVDAAYV    211 - 280
SKVDLESRVDTLTGEVNFLKYLFLTELSQVQTHISDTNVILSMDNNRSLDLDSIIDAVRTQYELIAQRSK    281 - 350
DEAEALYQTKYQELQITAGRHGDDLKNSKMEIAELNRTVQRLQAEISNVKKQIEQMQSLISDAEERGEQA    351 - 420
LQDAWQKLQDLEEALQQSKEELARLLRDYQAMLGVKLSLDVEIATYRQLLEGEESRMSGELQSHVSISVQ    421 - 490
NSQVSVNGGAGGGGSYGSGGYGGGSGGGYGGGRSYRGGGARGRSGGGYGSGCGGGGGSYGGSGRSGRGSS    491 - 560
RVQIIQTSTNTSHRRILE                                                        561 - 578
//

Text Mined References (7)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
16831889 2006 New consensus nomenclature for mammalian keratins.
16541075 2006 The finished DNA sequence of human chromosome 12.
16117782 2005 Characterization of a novel human type II epithelial keratin K1b, specifically expressed in eccrine sweat glands.
15737194 2005 Characterization of new members of the human type II keratin gene family and a general evaluation of the keratin gene domain on chromosome 12q13.13.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11683385 2001 Genes for intermediate filament proteins and the draft sequence of the human genome: novel keratin genes and a surprisingly high number of pseudogenes related to keratin genes 8 and 18.