Property Summary

NCBI Gene PubMed Count 7
PubMed Score 26.78
PubTator Score 25.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 2.5e-45
Atopic dermatitis 952 4.3e-03
Disease Target Count Z-score Confidence
Aggressive digital papillary adenocarcinoma 1 3.998 2.0

Expression

  Differential Expression (2)

Disease log2 FC p
Atopic dermatitis -1.400 4.3e-03
psoriasis -2.900 2.5e-45

Gene RIF (1)

AA Sequence

MSHQFSSQSAFSSMSRRVYSTSSSAGSGGGSPAVGSVCYARGRCGGGGYGIHGRGFGSRSLYNLGGSRSI      1 - 70
SINLMGRSTSGFCQGGGVGGFGGGRGFGVGSTGAGGFGGGGFGGAGFGTSNFGLGGFGPYCPPGGIQEVT     71 - 140
INQSLLEPLHLEVDPEIQRIKTQEREQIMVLNNKFASFIDKVRFLEQQNQVLQTKWELLQQVNTSTGTNN    141 - 210
LEPLLENYIGDLRRQVDLLSAEQMRQNAEVRSMQDVVEDYKSKYEDEINKRTGSENDFVVLKKDVDAAYV    211 - 280
SKVDLESRVDTLTGEVNFLKYLFLTELSQVQTHISDTNVILSMDNNRSLDLDSIIDAVRTQYELIAQRSK    281 - 350
DEAEALYQTKYQELQITAGRHGDDLKNSKMEIAELNRTVQRLQAEISNVKKQIEQMQSLISDAEERGEQA    351 - 420
LQDAWQKLQDLEEALQQSKEELARLLRDYQAMLGVKLSLDVEIATYRQLLEGEESRMSGELQSHVSISVQ    421 - 490
NSQVSVNGGAGGGGSYGSGGYGGGSGGGYGGGRSYRGGGARGRSGGGYGSGCGGGGGSYGGSGRSGRGSS    491 - 560
RVQIIQTSTNTSHRRILE                                                        561 - 578
//

Text Mined References (7)

PMID Year Title