Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.16
PubTator Score 0.26

Knowledge Summary


No data available


AA Sequence

ALGILCTLFGILAYTHFKLSEQEGSRSKLAQRP                                         281 - 313

Text Mined References (6)

PMID Year Title
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.