Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.57
PubTator Score 0.26

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q7Z769 A8K0T0 Q0P5Y5 Q9P0V1
Symbols BLOV1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MALLVDRVRGHWRIAAGLLFNLLVSICIVFLNKWIYVYHGFPNMSLTLVHFVVTWLGLYICQKLDIFAPK      1 - 70
SLPPSRLLLLALSFCGFVVFTNLSLQNNTIGTYQLAKAMTTPVIIAIQTFCYQKTFSTRIQLTLIPITLG     71 - 140
VILNSYYDVKFNFLGMVFAALGVLVTSLYQVWVGAKQHELQVNSMQLLYYQAPMSSAMLLVAVPFFEPVF    141 - 210
GEGGIFGPWSVSALLMVLLSGVIAFMVNLSIYWIIGNTSPVTYNMFGHFKFCITLFGGYVLFKDPLSINQ    211 - 280
ALGILCTLFGILAYTHFKLSEQEGSRSKLAQRP                                         281 - 313
//

Text Mined References (9)

PMID Year Title