Property Summary

NCBI Gene PubMed Count 23
PubMed Score 0.00
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
aldosterone-producing adenoma -1.873 2.5e-02
atypical teratoid / rhabdoid tumor 1.900 7.9e-06
breast carcinoma 1.200 1.2e-10
ependymoma 1.600 1.0e-02
glioblastoma 2.100 2.5e-05
group 4 medulloblastoma 1.500 1.6e-02
invasive ductal carcinoma 1.300 2.6e-02
medulloblastoma, large-cell 2.400 1.2e-05
Multiple myeloma 1.424 5.5e-03
oligodendroglioma 1.400 1.4e-02
osteosarcoma 3.058 1.8e-05
ovarian cancer -1.100 5.8e-04
pediatric high grade glioma 1.200 1.4e-02
primitive neuroectodermal tumor 1.100 8.5e-04

Gene RIF (4)

AA Sequence

MSATSVDQRPKGQGNKVSVQNGSIHQKDAVNDDDFEPYLSSQTNQSNSYPPMSDPYMPSYYAPSIGFPYS      1 - 70
LGEAAWSTAGDQPMPYLTTYGQMSNGEHHYIPDGVFSQPGALGNTPPFLGQHGFNFFPGNADFSTWGTSG     71 - 140
SQGQSTQSSAYSSSYGYPPSSLGRAITDGQAGFGNDTLSKVPGISSIEQGMTGLKIGGDLTAAVTKTVGT    141 - 210
ALSSSGMTSIATNSVPPVSSAAPKPTSWAAIARKPAKPQPKLKPKGNVGIGGSAVPPPPIKHNMNIGTWD    211 - 280
EKGSVVKAPPTQPVLPPQTIIQQPQPLIQPPPLVQSQLPQQQPQPPQPQQQQGPQPQAQPHQVQPQQQQL    281 - 350
QNRWVAPRNRGAGFNQNNGAGSENFGLGVVPVSASPSSVEVHPVLEKLKAINNYNPKDFDWNLKNGRVFI    351 - 420
IKSYSEDDIHRSIKYSIWCSTEHGNKRLDAAYRSLNGKGPLYLLFSVNGSGHFCGVAEMKSVVDYNAYAG    421 - 490
VWSQDKWKGKFEVKWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIIATFKHTTSIF    491 - 560
DDFAHYEKRQEEEEAMRRERNRNKQ                                                 561 - 585
//

Text Mined References (29)

PMID Year Title