Property Summary

NCBI Gene PubMed Count 20
PubMed Score 0.00
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Multiple myeloma 1.424 0.005
ependymoma 1.600 0.010
oligodendroglioma 1.400 0.014
osteosarcoma 3.058 0.000
atypical teratoid / rhabdoid tumor 1.900 0.000
glioblastoma 2.100 0.000
medulloblastoma 1.700 0.002
medulloblastoma, large-cell 2.400 0.000
primitive neuroectodermal tumor 1.100 0.001
pediatric high grade glioma 1.200 0.014
aldosterone-producing adenoma -1.873 0.025
breast carcinoma 1.200 0.000
invasive ductal carcinoma 1.300 0.026
ovarian cancer -1.100 0.001

Gene RIF (2)

PMID Text
22190034 HIV-1 NC is identified to have a physical interaction with YTH domain family, member 3 (YTHDF3) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20463905 Includes a multi-species analysis of YTHDF family members.

AA Sequence

MSATSVDQRPKGQGNKVSVQNGSIHQKDAVNDDDFEPYLSSQTNQSNSYPPMSDPYMPSYYAPSIGFPYS      1 - 70
LGEAAWSTAGDQPMPYLTTYGQMSNGEHHYIPDGVFSQPGALGNTPPFLGQHGFNFFPGNADFSTWGTSG     71 - 140
SQGQSTQSSAYSSSYGYPPSSLGRAITDGQAGFGNDTLSKVPGISSIEQGMTGLKIGGDLTAAVTKTVGT    141 - 210
ALSSSGMTSIATNSVPPVSSAAPKPTSWAAIARKPAKPQPKLKPKGNVGIGGSAVPPPPIKHNMNIGTWD    211 - 280
EKGSVVKAPPTQPVLPPQTIIQQPQPLIQPPPLVQSQLPQQQPQPPQPQQQQGPQPQAQPHQVQPQQQQL    281 - 350
QNRWVAPRNRGAGFNQNNGAGSENFGLGVVPVSASPSSVEVHPVLEKLKAINNYNPKDFDWNLKNGRVFI    351 - 420
IKSYSEDDIHRSIKYSIWCSTEHGNKRLDAAYRSLNGKGPLYLLFSVNGSGHFCGVAEMKSVVDYNAYAG    421 - 490
VWSQDKWKGKFEVKWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIIATFKHTTSIF    491 - 560
DDFAHYEKRQEEEEAMRRERNRNKQ                                                 561 - 585
//

Text Mined References (25)

PMID Year Title
26458103 2015 Dynamic m(6)A mRNA methylation directs translational control of heat shock response.
24284625 2014 N6-methyladenosine-dependent regulation of messenger RNA stability.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22575960 2012 Topology of the human and mouse m6A RNA methylomes revealed by m6A-seq.
22194214 2012 Replication study of 10 genes showing evidence for association with multiple sclerosis: validation of TMEM39A, IL12B and CBLB [correction of CLBL] genes.
22190034 2011 Global landscape of HIV-human protein complexes.
21269460 2011 Initial characterization of the human central proteome.
20463905 2010 Concomitant duplications of opioid peptide and receptor genes before the origin of jawed vertebrates.
More...