Property Summary

NCBI Gene PubMed Count 20
PubMed Score 0.00
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
IGA Glomerulonephritis 454
Disease Target Count P-value
breast carcinoma 1614 1.20782296489675E-10
atypical teratoid / rhabdoid tumor 4369 7.90684191085391E-6
medulloblastoma, large-cell 6234 1.16238180165768E-5
osteosarcoma 7933 1.81057490879334E-5
glioblastoma 5572 2.50447692559967E-5
ovarian cancer 8492 5.84000226887297E-4
primitive neuroectodermal tumor 3031 8.52208648174843E-4
medulloblastoma 1524 0.00179574838285368
Multiple myeloma 1328 0.00547398988877413
ependymoma 2514 0.0104270686899652
oligodendroglioma 2849 0.0136801116848842
pediatric high grade glioma 2712 0.0144079272409454
aldosterone-producing adenoma 664 0.0252460083964877
invasive ductal carcinoma 2950 0.0256037487631322

Expression

  Differential Expression (14)

Disease log2 FC p
Multiple myeloma 1.424 0.005
ependymoma 1.600 0.010
oligodendroglioma 1.400 0.014
osteosarcoma 3.058 0.000
atypical teratoid / rhabdoid tumor 1.900 0.000
glioblastoma 2.100 0.000
medulloblastoma 1.700 0.002
medulloblastoma, large-cell 2.400 0.000
primitive neuroectodermal tumor 1.100 0.001
pediatric high grade glioma 1.200 0.014
aldosterone-producing adenoma -1.873 0.025
breast carcinoma 1.200 0.000
invasive ductal carcinoma 1.300 0.026
ovarian cancer -1.100 0.001

Synonym

Accession Q7Z739 B3KXL4 Q63Z37 Q659A3
Symbols

Gene

  Ortholog (5)

Species Source
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (2)

PMID Text
22190034 HIV-1 NC is identified to have a physical interaction with YTH domain family, member 3 (YTHDF3) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20463905 Includes a multi-species analysis of YTHDF family members.

AA Sequence

MSATSVDQRPKGQGNKVSVQNGSIHQKDAVNDDDFEPYLSSQTNQSNSYPPMSDPYMPSYYAPSIGFPYS      1 - 70
LGEAAWSTAGDQPMPYLTTYGQMSNGEHHYIPDGVFSQPGALGNTPPFLGQHGFNFFPGNADFSTWGTSG     71 - 140
SQGQSTQSSAYSSSYGYPPSSLGRAITDGQAGFGNDTLSKVPGISSIEQGMTGLKIGGDLTAAVTKTVGT    141 - 210
ALSSSGMTSIATNSVPPVSSAAPKPTSWAAIARKPAKPQPKLKPKGNVGIGGSAVPPPPIKHNMNIGTWD    211 - 280
EKGSVVKAPPTQPVLPPQTIIQQPQPLIQPPPLVQSQLPQQQPQPPQPQQQQGPQPQAQPHQVQPQQQQL    281 - 350
QNRWVAPRNRGAGFNQNNGAGSENFGLGVVPVSASPSSVEVHPVLEKLKAINNYNPKDFDWNLKNGRVFI    351 - 420
IKSYSEDDIHRSIKYSIWCSTEHGNKRLDAAYRSLNGKGPLYLLFSVNGSGHFCGVAEMKSVVDYNAYAG    421 - 490
VWSQDKWKGKFEVKWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIIATFKHTTSIF    491 - 560
DDFAHYEKRQEEEEAMRRERNRNKQ                                                 561 - 585
//

Text Mined References (25)

PMID Year Title
26458103 2015 Dynamic m(6)A mRNA methylation directs translational control of heat shock response.
24284625 2014 N6-methyladenosine-dependent regulation of messenger RNA stability.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22575960 2012 Topology of the human and mouse m6A RNA methylomes revealed by m6A-seq.
22194214 2012 Replication study of 10 genes showing evidence for association with multiple sclerosis: validation of TMEM39A, IL12B and CBLB [correction of CLBL] genes.
22190034 2011 Global landscape of HIV-human protein complexes.
21269460 2011 Initial characterization of the human central proteome.
20463905 2010 Concomitant duplications of opioid peptide and receptor genes before the origin of jawed vertebrates.
More...