Property Summary

NCBI Gene PubMed Count 7
Grant Count 9
Funding $314,620.66
PubMed Score 124.30
PubTator Score 129.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Cancer 2,346 4.749 2.4
Myoma 12 3.851 1.9

AA Sequence

MVDYYEVLGLQRYASPEDIKKAYHKVALKWHPDKNPENKEEAERKFKEVAEAYEVLSNDEKRDIYDKYGT      1 - 70
EGLNGGGSHFDDECEYGFTFHKPDDVFKEIFHERDPFSFHFFEDSLEDLLNRPGSSYGNRNRDAGYFFST     71 - 140
ASEYPIFEKFSSYDTGYTSQGSLGHEGLTSFSSLAFDNSGMDNYISVTTSDKIVNGRNINTKKIIESDQE    141 - 210
REAEDNGELTFFLVNSVANEEGFAKECSWRTQSFNNYSPNSHSSKHVSQYTFVDNDEGGISWVTSNRDPP    211 - 280
IFSAGVKEGGKRKKKKRKEVQKKSTKRNC                                             281 - 309
//

Text Mined References (7)

PMID Year Title
21231916 2011 The diverse members of the mammalian HSP70 machine show distinct chaperone-like activities.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11147971 2000 Mammalian HSP40/DNAJ homologs: cloning of novel cDNAs and a proposal for their classification and nomenclature.
10591208 1999 The DNA sequence of human chromosome 22.