Property Summary

NCBI Gene PubMed Count 7
PubMed Score 124.30
PubTator Score 129.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count Z-score Confidence
Cancer 2346 4.749 2.4
Myoma 12 3.851 1.9

Synonym

Accession Q7Z6W7 Q2M220 Q5H904 Q8WYJ7
Symbols DJ5
HSC3

Gene

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid

 GO Function (1)

 Compartment GO Term (1)

AA Sequence

MVDYYEVLGLQRYASPEDIKKAYHKVALKWHPDKNPENKEEAERKFKEVAEAYEVLSNDEKRDIYDKYGT      1 - 70
EGLNGGGSHFDDECEYGFTFHKPDDVFKEIFHERDPFSFHFFEDSLEDLLNRPGSSYGNRNRDAGYFFST     71 - 140
ASEYPIFEKFSSYDTGYTSQGSLGHEGLTSFSSLAFDNSGMDNYISVTTSDKIVNGRNINTKKIIESDQE    141 - 210
REAEDNGELTFFLVNSVANEEGFAKECSWRTQSFNNYSPNSHSSKHVSQYTFVDNDEGGISWVTSNRDPP    211 - 280
IFSAGVKEGGKRKKKKRKEVQKKSTKRNC                                             281 - 309
//

Text Mined References (7)

PMID Year Title
21231916 2011 The diverse members of the mammalian HSP70 machine show distinct chaperone-like activities.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11147971 2000 Mammalian HSP40/DNAJ homologs: cloning of novel cDNAs and a proposal for their classification and nomenclature.
10591208 1999 The DNA sequence of human chromosome 22.