Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MSTSSSSSWDNLLESLSLSTVWNWIQASFLGETSAPQQTSLGLLDNLAPAVQIILRISFLILLGIGIYAL      1 - 70
WKRSIQSIQKTLLFVITLYKLYKKGSHIFEALLANPEGSGLRIQDNNNLFLSLGLQEKILKKLKTVENKM     71 - 140
KNLEGIIVAQKPATKRDCSSEPYCSCSDCQSPLSTSGFTSPI                                141 - 182
//

Text Mined References (4)

PMID Year Title