Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MSTSSSSSWDNLLESLSLSTVWNWIQASFLGETSAPQQTSLGLLDNLAPAVQIILRISFLILLGIGIYAL      1 - 70
WKRSIQSIQKTLLFVITLYKLYKKGSHIFEALLANPEGSGLRIQDNNNLFLSLGLQEKILKKLKTVENKM     71 - 140
KNLEGIIVAQKPATKRDCSSEPYCSCSDCQSPLSTSGFTSPI                                141 - 182
//

Text Mined References (4)

PMID Year Title
21630459 2011 Proteomic characterization of the human sperm nucleus.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.