Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.66
PubTator Score 6.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 3.18650089232737E-6
medulloblastoma, large-cell 6234 0.00216645435850628
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Synonym

Accession Q7Z6R9 Q8IWX0 AP2-delta
Symbols TFAP2BL1

Gene

PANTHER Protein Class (1)

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG
Zebrafish OMA EggNOG Inparanoid

Gene RIF (3)

PMID Text
24789576 Ap-2delta was identified as a new activating transcription factor of HMOX1.
16684505 Taken together, these results suggest that AP-2epsilon and Ets-1 are involved in the regulation of integrin alpha10 transcription in chondrocytes.
11733187 cloning and characterization of a novel human transcription factor AP-2 like gene (TFAP2BL1), which is located on human chromosome 6p12.1-21.1

AA Sequence

MSTTFPGLVHDAEIRHDGSNSYRLMQLGCLESVANSTVAYSSSSPLTYSTTGTEFASPYFSTNHQYTPLH      1 - 70
HQSFHYEFQHSHPAVTPDAYSLNSLHHSQQYYQQIHHGEPTDFINLHNARALKSSCLDEQRRELGCLDAY     71 - 140
RRHDLSLMSHGSQYGMHPDQRLLPGPSLGLAAAGADDLQGSVEAQCGLVLNGQGGVIRRGGTCVVNPTDL    141 - 210
FCSVPGRLSLLSSTSKYKVTIAEVKRRLSPPECLNASLLGGILRRAKSKNGGRCLREKLDRLGLNLPAGR    211 - 280
RKAANVTLLTSLVEGEALHLARDFGYTCETEFPAKAVGEHLARQHMEQKEQTARKKMILATKQICKEFQD    281 - 350
LLSQDRSPLGSSRPTPILDLDIQRHLTHFSLITHGFGTPAICAALSTFQTVLSEMLNYLEKHTTHKNGGA    351 - 420
ADSGQGHANSEKAPLRKTSEAAVKEGKTEKTD                                          421 - 452
//

Text Mined References (8)

PMID Year Title
25133637 2014 Genome-wide association studies and heritability estimates of body mass index related phenotypes in Bangladeshi adults.
24789576 2014 Regulation of the HMOX1 gene by the transcription factor AP-2? with unique DNA binding site.
17213182 2006 Identification of genes related to Parkinson's disease using expressed sequence tags.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16684505 2006 Regulation of integrin alpha10 expression in chondrocytes by the transcription factors AP-2epsilon and Ets-1.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11733187 2002 Cloning and characterization of a novel human transcription factor AP-2 beta like gene (TFAP2BL1).