Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.11

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q7Z6P3
Symbols RASD3
RASL13
dJ431A14.3

Gene

  Ortholog (5)

Species Source
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG
Pig OMA EggNOG Inparanoid

AA Sequence

MQDVLEAKEREVQRLAEGQRELEAQLSHLRSTHQEAASENQQLQEAKRDLAGRLEEVRGQLQVTRGRLDA      1 - 70
ARGRVSWQVEEKLRQVAAIPGLGFPGAGEKTPDPQAASPEEAPLPGLFGDNDDWDQLLSNFGSPPHGALQ     71 - 140
LCWSPPPTPRATSGPQTPRVVRQISISEPQAFLFGQEPSSDPDGAPRTPPGVTFSAKDNKGVDPHEQDIR    141 - 210
AEQPVEPHDPDPNQEPGSTPEGRLLWGLSGSLVAPAFKVLIPLEDGPPPPANSPPPQAPAGSSKQIQASD    211 - 280
PDDKGPGQRDALQQDLHATGSEPRLGTQRARALTLGPAEPFQGLEFVGPVPTERLEQGQAGPAVQEGLPE    281 - 350
GLREAHGQVLGLGELSAFPHQELEEEPRSEEGKQEGRGGQDLSSEQSEQSVEAHGLETAHSELPQQDSLL    351 - 420
VSLPSATPQAQVEAEGPTPGKSAPPRGSPPRGAQPGAGAGPQEPTQTPPTMAEQEAQPRPSLTTAHAEEQ    421 - 490
GPPHSREPRAESRLEDPGMDSREAGLTPSPGDPMAGGGPQANPDYLFHVIFLGDSNVGKTSFLHLLHQNS    491 - 560
FATGLTATVGVDFRVKTLLVDNKCFVLQLWDTAGQERYHSMTRQLLRKADGVVLMYDITSQESFAHVRYW    561 - 630
LDCLQDAGSDGVVILLLGNKMDCEEERQVSVEAGQQLAQELGVYFGECSAALGHNILEPVVNLARSLRMQ    631 - 700
EEGLKDSLVKVAPKRPPKRFGCC                                                   701 - 723
//

Text Mined References (3)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.