Property Summary

NCBI Gene PubMed Count 9
PubMed Score 6.30
PubTator Score 3.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
osteosarcoma 7,933

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -2.350 0.000

Synonym

Accession Q7Z6M4 A8K6K0 Q9P0E0
Symbols MTERFD2

Gene

PDB

4FP9   4FZV  

Gene RIF (1)

PMID Text
22949673 analysis of the 3D crystal structure of the human MTERF4-NSUN4 complex

AA Sequence

MAAFGRQVLDWHRLIPLTWACMARQTPHLGEQRRTTASLLRKLTTASNGGVIEELSCVRSNNYVQEPECR      1 - 70
RNLVQCLLEKQGTPVVQGSLELERVMSSLLDMGFSNAHINELLSVRRGASLQQLLDIISEFILLGLNPEP     71 - 140
VCVVLKKSPQLLKLPIMQMRKRSSYLQKLGLGEGKLKRVLYCCPEIFTMRQQDINDTVRLLKEKCLFTVQ    141 - 210
QVTKILHSCPSVLREDLGQLEYKFQYAYFRMGIKHPDIVKSEYLQYSLTKIKQRHIYLERLGRYQTPDKK    211 - 280
GQTQIPNPLLKDILRVSEAEFLARTACTSVEEFQVFKKLLAREEEESESSTSDDKRASLDEDEDDDDEED    281 - 350
NDEDDNDEDDDDEDDDEAEDNDEDEDDDEEE                                           351 - 381
//

Text Mined References (12)

PMID Year Title
23022348 2012 Structure of the essential MTERF4:NSUN4 protein complex reveals how an MTERF protein collaborates to facilitate rRNA modification.
22949673 2012 Structure of the human MTERF4-NSUN4 protein complex that regulates mitochondrial ribosome biogenesis.
22675492 2012 Genome-wide association study of circulating estradiol, testosterone, and sex hormone-binding globulin in postmenopausal women.
21531335 2011 MTERF4 regulates translation by targeting the methyltransferase NSUN4 to the mammalian mitochondrial ribosome.
21269460 2011 Initial characterization of the human central proteome.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16193327 2005 A family of putative transcription termination factors shared amongst metazoans and plants.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...