Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.42
PubTator Score 2.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -2.400 2.1e-05
Astrocytoma, Pilocytic -1.200 1.8e-03
atypical teratoid / rhabdoid tumor -1.900 9.1e-05
ependymoma -1.500 1.6e-06
glioblastoma -1.600 3.8e-05
group 4 medulloblastoma -1.600 2.6e-03
intraductal papillary-mucinous adenoma (... 1.400 6.2e-04
intraductal papillary-mucinous carcinoma... 1.300 3.1e-03
medulloblastoma, large-cell -2.600 4.6e-05
osteosarcoma -1.215 8.3e-06
ovarian cancer -1.200 1.7e-05
primitive neuroectodermal tumor -1.600 1.3e-04
spina bifida -1.068 3.0e-02
tuberculosis and treatment for 6 months 1.100 1.5e-05

Synonym

Accession Q7Z6M2 Q6PIR2 Q86TR2 Q86YE0
Symbols Fbx33
BMND12
c14_5247

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Process (1)

 Compartment GO Term (1)

Gene RIF (2)

AA Sequence

MLLFLSVPQPRPPGARTRAGAARVARWRRLRLQQLRRLRGLLRVLRGRPGAGSRRRGRMALCGQAAGAAS      1 - 70
LPSELIVHIFSFLPAPDRLRASASCSHWRECLFYPALWPQLRICLRVSPAEQPRLEFLMRKCGWFVRELR     71 - 140
VEFAAENYLSGGGPGDGGGADTGTGGEEVEALQLSARWLEVLRTYLELVLCVLVSIRNNRNLQKFSLFGD    141 - 210
ISVLQQQGSLSNTYLSKVDPDGKKIKQIQQLFEEILSNSRQLKWLSCGFMLEIVTPTSLSSLSNAVANTM    211 - 280
EHLSLLDNNIPGNSTLITAVELERFVNLHSLALDFCDFTAEMARVLTDSNHVPLQRLSLLVHNVSVMHKS    281 - 350
LDNMPNDEHWKALSRKSTSFRVYIMAFDIKSEDMLKILKPSIPLERIHFDSYITCVSGAIVDLISRQYDK    351 - 420
FLTHFILMNDVIDTSGFPDLSDNRNEDPLVLLAWRCTKLSLLAIHGYTVWAHNLIAIARLRGSDLKVLEV    421 - 490
TEESIDFDQGELADQDVDPVHNLIEQVSLGLGQPWHAVMDIESLSVFTEPNRHFYREMQSFSEDI         491 - 555
//

Text Mined References (7)

PMID Year Title