Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.41
PubTator Score 0.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (3)

Disease log2 FC p
lung cancer 1.500 6.5e-04
osteosarcoma -1.406 6.7e-05
pancreatic ductal adenocarcinoma liver m... -1.046 9.9e-03

Gene RIF (3)

AA Sequence

MKQLPVLEPGDKPRKATWYTLTVPGDSPCARVGHSCSYLPPVGNAKRGKVFIVGGANPNRSFSDVHTMDL      1 - 70
GKHQWDLDTCKGLLPRYEHASFIPSCTPDRIWVFGGANQSGNRNCLQVLNPETRTWTTPEVTSPPPSPRT     71 - 140
FHTSSAAIGNQLYVFGGGERGAQPVQDTKLHVFDANTLTWSQPETLGNPPSPRHGHVMVAAGTKLFIHGG    141 - 210
LAGDRFYDDLHCIDISDMKWQKLNPTGAAPAGCAAHSAVAMGKHVYIFGGMTPAGALDTMYQYHTEEQHW    211 - 280
TLLKFDTLLPPGRLDHSMCIIPWPVTCASEKEDSNSLTLNHEAEKEDSADKVMSHSGDSHEESQTATLLC    281 - 350
LVFGGMNTEGEIYDDCIVTVVD                                                    351 - 372
//

Text Mined References (14)

PMID Year Title