Property Summary

NCBI Gene PubMed Count 97
PubMed Score 346.38
PubTator Score 725.39

Knowledge Summary

Patent

No data available

Expression

 GO Function (1)

Protein-protein Interaction (7)

Gene RIF (82)

AA Sequence

MAASSSEISEMKGVEESPKVPGEGPGHSEAETGPPQVLAGVPDQPEAPQPGPNTTAAPVDSGPKAGLAPE      1 - 70
TTETPAGASETAQATDLSLSPGGESKANCSPEDPCQETVSKPEVSKEATADQGSRLESAAPPEPAPEPAP     71 - 140
QPDPRPDSQPTPKPALQPELPTQEDPTPEILSESVGEKQENGAVVPLQAGDGEEGPAPEPHSPPSKKSPP    141 - 210
ANGAPPRVLQQLVEEDRMRRAHSGHPGSPRGSLSRHPSSQLAGPGVEGGEGTQKPRDYIILAILSCFCPM    211 - 280
WPVNIVAFAYAVMSRNSLQQGDVDGAQRLGRVAKLLSIVALVGGVLIIIASCVINLGVYK              281 - 340
//

Text Mined References (96)

PMID Year Title