Property Summary

NCBI Gene PubMed Count 10
Grant Count 1
R01 Count 1
Funding $127,600
PubMed Score 2.43
PubTator Score 9.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Gene RIF (1)

PMID Text
25892881 Arpin protein affects the expression of tight junction proteins and may have an impact on bacterial translocation in severe acute pancreatitis.

AA Sequence

MSRIYHDGALRNKAVQSVRLPGAWDPAAHQGGNGVLLEGELIDVSRHSILDTHGRKERYYVLYIRPSHIH      1 - 70
RRKFDAKGNEIEPNFSATRKVNTGFLMSSYKVEAKGDTDRLTPEALKGLVNKPELLALTESLTPDHTVAF     71 - 140
WMPESEMEVMELELGAGVRLKTRGDGPFLDSLAKLEAGTVTKCNFTGDGKTGASWTDNIMAQKCSKGAAA    141 - 210
EIREQGDGAEDEEWDD                                                          211 - 226
//

Text Mined References (11)

PMID Year Title
25892881 2015 Arpin contributes to bacterial translocation and development of severe acute pancreatitis.
25416956 2014 A proteome-scale map of the human interactome network.
24132237 2013 Inhibitory signalling to the Arp2/3 complex steers cell migration.
20585627 2010 Web-based, participant-driven studies yield novel genetic associations for common traits.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...