Property Summary

NCBI Gene PubMed Count 6
PubMed Score 13.70
PubTator Score 3.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
ependymoma 1.500 0.023
osteosarcoma -1.118 0.010
spina bifida -2.062 0.049
ulcerative colitis -1.200 0.000

Gene RIF (1)

PMID Text
24778018 NRARP may stimulate cell proliferation in human breast cancer.

AA Sequence

MSQAELSTCSAPQTQRIFQEAVRKGNTQELQSLLQNMTNCEFNVNSFGPEGQTALHQSVIDGNLELVKLL      1 - 70
VKFGADIRLANRDGWSALHIAAFGGHQDIVLYLITKAKYAASGR                               71 - 114
//

Text Mined References (8)

PMID Year Title
25985737 2015 C8orf4 negatively regulates self-renewal of liver cancer stem cells via suppression of NOTCH2 signalling.
24778018 2014 Overexpression of NOTCH-regulated ankyrin repeat protein is associated with breast cancer cell proliferation.
19154719 2009 Nrarp coordinates endothelial Notch and Wnt signaling to control vessel density in angiogenesis.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.