Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.75
PubTator Score 2.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (3)

Disease log2 FC p
active Crohn's disease 1.151 3.5e-03
hepatocellular carcinoma 1.100 8.8e-05
pancreatic ductal adenocarcinoma liver m... -1.471 6.5e-03

Gene RIF (4)

AA Sequence

MPRYCAAICCKNRRGRNNKDRKLSFYPFPLHDKERLEKWLKNMKRDSWVPSKYQFLCSDHFTPDSLDIRW      1 - 70
GIRYLKQTAVPTIFSLPEDNQGKDPSKKKSQKKNLEDEKEVCPKAKSEESFVLNETKKNIVNTDVPHQHP     71 - 140
ELLHSSSLVKPPAPKTGSIQNNMLTLNLVKQHTGKPESTLETSVNQDTGRGGFHTCFENLNSTTITLTTS    141 - 210
NSESIHQSLETQEVLEVTTSHLANPNFTSNSMEIKSAQENPFLFSTINQTVEELNTNKESVIAIFVPAEN    211 - 280
SKPSVNSFISAQKETTEMEDTDIEDSLYKDVDYGTEVLQIEHSYCRQDINKEHLWQKVSKLHSKITLLEL    281 - 350
KEQQTLGRLKSLEALIRQLKQENWLSEENVKIIENHFTTYEVTMI                             351 - 395
//

Text Mined References (10)

PMID Year Title