Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.59
PubTator Score 0.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 1.4516634318344E-4
posterior fossa group B ependymoma 1530 0.0028855058475927
non primary Sjogren syndrome sicca 840 0.0194752497110623
chronic rhinosinusitis 512 0.0404859573385744
Disease Target Count Z-score Confidence
Aggressive periodontitis 10 3.446 1.7

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.653 0.000
posterior fossa group B ependymoma 1.200 0.003
non primary Sjogren syndrome sicca -1.200 0.019
chronic rhinosinusitis -1.109 0.040

Synonym

Accession Q7Z6J8 B4DP63 Q5T4W2 Q6IPR4 Q75UG0 Q9NT42
Symbols H10BH
UBE2CBP
YJR141W
C6orf157

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG
Xenopus OMA EggNOG
Zebrafish OMA EggNOG Inparanoid

 GWAS Trait (1)

Gene RIF (2)

PMID Text
25872646 A novel missense SNV, rs7739323, is strongly associated with age-related macular degeneration in an East Asian population.
15749827 The carboxyl terminal half of H10BH was able to bind cyclin B and ubiquitinylate cyclin B in vitro.

AA Sequence

MAASAAETRVFLEVRGQLQSALLILGEPKEGGMPMNISIMPSSLQMKTPEGCTEIQLPAEVRLVPSSCRG      1 - 70
LQFVVGDGLHLRLQTQAKLGTKLISMFNQSSQTQECCTFYCQSCGEVIIKDRKLLRVLPLPSENWGALVG     71 - 140
EWCCHPDPFANKSLHPQENDCFIGDSFFLVNLRTSLWQQRPELSPVEMCCVSSDNHCKLEPKANTKVICK    141 - 210
RCKVMLGETVSSETTKFYMTEIIIQSSERSFPIIPRSWFVQSVIAQCLVQLSSARSTFRFTIQGQDDKVY    211 - 280
ILLWLLNSDSLVIESLRNSKYIKKFPLLENTFKADSSSAWSAVKVLYQPCIKSRNEKLVSLWESDISVHP    281 - 350
LTLPSATCLELLLILSKSNANLPSSLRRVNSFQVAFLKM                                   351 - 389
//

Text Mined References (8)

PMID Year Title
25872646 2015 Whole-exome sequencing implicates UBE3D in age-related macular degeneration in East Asian populations.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15749827 2005 A novel UbcH10-binding protein facilitates the ubiquitinylation of cyclin B in vitro.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.