Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.59
PubTator Score 0.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Aggressive Periodontitis 12 3.429 1.7

Expression

  Differential Expression (4)

Disease log2 FC p
chronic rhinosinusitis -1.109 4.0e-02
non primary Sjogren syndrome sicca -1.200 1.9e-02
osteosarcoma -1.653 1.5e-04
posterior fossa group B ependymoma 1.200 2.9e-03

Synonym

Accession Q7Z6J8 B4DP63 Q5T4W2 Q6IPR4 Q75UG0 Q9NT42
Symbols H10BH
UBE2CBP
YJR141W
C6orf157

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GWAS Trait (1)

Protein-protein Interaction (10)

Gene RIF (3)

AA Sequence

MAASAAETRVFLEVRGQLQSALLILGEPKEGGMPMNISIMPSSLQMKTPEGCTEIQLPAEVRLVPSSCRG      1 - 70
LQFVVGDGLHLRLQTQAKLGTKLISMFNQSSQTQECCTFYCQSCGEVIIKDRKLLRVLPLPSENWGALVG     71 - 140
EWCCHPDPFANKSLHPQENDCFIGDSFFLVNLRTSLWQQRPELSPVEMCCVSSDNHCKLEPKANTKVICK    141 - 210
RCKVMLGETVSSETTKFYMTEIIIQSSERSFPIIPRSWFVQSVIAQCLVQLSSARSTFRFTIQGQDDKVY    211 - 280
ILLWLLNSDSLVIESLRNSKYIKKFPLLENTFKADSSSAWSAVKVLYQPCIKSRNEKLVSLWESDISVHP    281 - 350
LTLPSATCLELLLILSKSNANLPSSLRRVNSFQVAFLKM                                   351 - 389
//

Text Mined References (9)

PMID Year Title