Property Summary

NCBI Gene PubMed Count 3
Grant Count 2
Funding $90,654.03
PubMed Score 1.59
PubTator Score 0.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.653 0.000
posterior fossa group B ependymoma 1.200 0.003
non primary Sjogren syndrome sicca -1.200 0.019
chronic rhinosinusitis -1.109 0.040

Gene RIF (2)

PMID Text
25872646 A novel missense SNV, rs7739323, is strongly associated with age-related macular degeneration in an East Asian population.
15749827 The carboxyl terminal half of H10BH was able to bind cyclin B and ubiquitinylate cyclin B in vitro.

AA Sequence

MAASAAETRVFLEVRGQLQSALLILGEPKEGGMPMNISIMPSSLQMKTPEGCTEIQLPAEVRLVPSSCRG      1 - 70
LQFVVGDGLHLRLQTQAKLGTKLISMFNQSSQTQECCTFYCQSCGEVIIKDRKLLRVLPLPSENWGALVG     71 - 140
EWCCHPDPFANKSLHPQENDCFIGDSFFLVNLRTSLWQQRPELSPVEMCCVSSDNHCKLEPKANTKVICK    141 - 210
RCKVMLGETVSSETTKFYMTEIIIQSSERSFPIIPRSWFVQSVIAQCLVQLSSARSTFRFTIQGQDDKVY    211 - 280
ILLWLLNSDSLVIESLRNSKYIKKFPLLENTFKADSSSAWSAVKVLYQPCIKSRNEKLVSLWESDISVHP    281 - 350
LTLPSATCLELLLILSKSNANLPSSLRRVNSFQVAFLKM                                   351 - 389
//

Text Mined References (8)

PMID Year Title
25872646 2015 Whole-exome sequencing implicates UBE3D in age-related macular degeneration in East Asian populations.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15749827 2005 A novel UbcH10-binding protein facilitates the ubiquitinylation of cyclin B in vitro.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.