Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.59
PubTator Score 0.83

Knowledge Summary


No data available


  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Aggressive Periodontitis 12 3.429 1.7


  Differential Expression (4)

Disease log2 FC p
chronic rhinosinusitis -1.109 4.0e-02
non primary Sjogren syndrome sicca -1.200 1.9e-02
osteosarcoma -1.653 1.5e-04
posterior fossa group B ependymoma 1.200 2.9e-03

 GWAS Trait (1)

Protein-protein Interaction (10)

Gene RIF (3)

AA Sequence

LTLPSATCLELLLILSKSNANLPSSLRRVNSFQVAFLKM                                   351 - 389

Text Mined References (9)

PMID Year Title