Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.69
PubTator Score 1.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
active Crohn's disease 1.400 1.2e-02
adrenocortical carcinoma -1.460 4.1e-02
atypical teratoid / rhabdoid tumor -1.700 1.9e-04
cystic fibrosis 1.141 7.1e-05
group 3 medulloblastoma -2.000 5.5e-03
intraductal papillary-mucinous adenoma (... 1.200 6.1e-04
intraductal papillary-mucinous neoplasm ... 2.100 4.2e-03
lung adenocarcinoma 1.300 1.7e-07
medulloblastoma, large-cell -3.400 2.9e-07
osteosarcoma 1.044 5.5e-04
ovarian cancer 1.100 6.5e-07
pancreatic cancer 1.300 7.3e-05
Pick disease -1.400 2.9e-03
progressive supranuclear palsy -1.200 1.2e-02

Gene RIF (3)

AA Sequence

MLSRLMSGSSRSLEREYSCTVRLLDDSEYTCTIQRDAKGQYLFDLLCHHLNLLEKDYFGIRFVDPDKQRH      1 - 70
WLEFTKSVVKQLRSQPPFTMCFRVKFYPADPAALKEEITRYLVFLQIKRDLYHGRLLCKTSDAALLAAYI     71 - 140
LQAEIGDYDSGKHPEGYSSKFQFFPKHSEKLERKIAEIHKTELSGQTPATSELNFLRKAQTLETYGVDPH    141 - 210
PCKDVSGNAAFLAFTPFGFVVLQGNKRVHFIKWNEVTKLKFEGKTFYLYVSQKEEKKIILTYFAPTPEAC    211 - 280
KHLWKCGIENQAFYKLEKSSQVRTVSSSNLFFKGSRFRYSGRVAKEVMESSAKIKREPPEIHRAGMVPSR    281 - 350
SCPSITHGPRLSSVPRTRRRAVHISIMEGLESLRDSAHSTPVRSTSHGDTFLPHVRSSRTDSNERVAVIA    351 - 420
DEAYSPADSVLPTPVAEHSLELMLLSRQINGATCSIEEEKESEASTPTATEVEALGGELRALCQGHSGPE    421 - 490
EEQVNKFVLSVLRLLLVTMGLLFVLLLLLIILTESDLDIAFFRDIRQTPEFEQFHYQYFCPLRRWFACKI    491 - 560
RSVVSLLIDT                                                                561 - 570
//

Text Mined References (12)

PMID Year Title