Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.63
PubTator Score 1.40

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
25448675 FRMD5 regulates tumor cell motility via a dual pathway involving FRMD5 binding to integrin beta5 tail and to ROCK1
22846708 FRMD5 may play a role in p120-catenin-based cell-cell contact and is involved in the regulation of tumor progression

AA Sequence

MLSRLMSGSSRSLEREYSCTVRLLDDSEYTCTIQRDAKGQYLFDLLCHHLNLLEKDYFGIRFVDPDKQRH      1 - 70
WLEFTKSVVKQLRSQPPFTMCFRVKFYPADPAALKEEITRYLVFLQIKRDLYHGRLLCKTSDAALLAAYI     71 - 140
LQAEIGDYDSGKHPEGYSSKFQFFPKHSEKLERKIAEIHKTELSGQTPATSELNFLRKAQTLETYGVDPH    141 - 210
PCKDVSGNAAFLAFTPFGFVVLQGNKRVHFIKWNEVTKLKFEGKTFYLYVSQKEEKKIILTYFAPTPEAC    211 - 280
KHLWKCGIENQAFYKLEKSSQVRTVSSSNLFFKGSRFRYSGRVAKEVMESSAKIKREPPEIHRAGMVPSR    281 - 350
SCPSITHGPRLSSVPRTRRRAVHISIMEGLESLRDSAHSTPVRSTSHGDTFLPHVRSSRTDSNERVAVIA    351 - 420
DEAYSPADSVLPTPVAEHSLELMLLSRQINGATCSIEEEKESEASTPTATEVEALGGELRALCQGHSGPE    421 - 490
EEQVNKFVLSVLRLLLVTMGLLFVLLLLLIILTESDLDIAFFRDIRQTPEFEQFHYQYFCPLRRWFACKI    491 - 560
RSVVSLLIDT                                                                561 - 570
//

Text Mined References (11)

PMID Year Title
25448675 2014 FERM domain-containing protein FRMD5 regulates cell motility via binding to integrin ?5 subunit and ROCK1.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23022100 2012 Discovery and fine mapping of serum protein loci through transethnic meta-analysis.
22846708 2012 FERM-containing protein FRMD5 is a p120-catenin interacting protein that regulates tumor progression.
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...