Property Summary

NCBI Gene PubMed Count 14
PubMed Score 215.32
PubTator Score 60.60

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid/rhabdoid tumor -1.100 2.1e-05
breast carcinoma -1.300 9.5e-05
group 4 medulloblastoma -1.300 3.6e-04
lung adenocarcinoma -3.400 9.1e-16
non-inflammatory breast cancer -1.300 2.9e-03

Gene RIF (7)

AA Sequence

MTLRRLRKLQQKEEAAATPDPAARTPDSEVAPAAPVPTPGPPAAAATPGPPADELYAALEDYHPAELYRA      1 - 70
LAVSGGTLPRRKGSGFRWKNLSQSPEQQRKVLTLEKEDNQTFGFEIQTYGLHHREEQRVEMVTFVCRVHE     71 - 140
SSPAQLAGLTPGDTIASVNGLNVEGIRHREIVDIIKASGNVLRLETLYGTSIRKAELEARLQYLKQTLYE    141 - 210
KWGEYRSLMVQEQRLVHGLVVKDPSIYDTLESVRSCLYGAGLLPGSLPFGPLLAVPGRPRGGARRARGDA    211 - 280
DDAVYHTCFFGDSEPPALPPPPPPARAFGPGPAETPAVGPGPGPRAALSRSASVRCAGPGGGGGGGAPGA    281 - 350
LWTEAREQALCGPGLRKTKYRSFRRRLLKFIPGLNRSLEEEESQL                             351 - 395
//

Text Mined References (15)

PMID Year Title