Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
juvenile dermatomyositis 1189 1.23170436014824E-10
acute quadriplegic myopathy 1157 1.85393418305903E-6
osteosarcoma 7933 6.32109997058083E-6
medulloblastoma, large-cell 6234 2.15869400747272E-5
tuberculosis and treatment for 6 months 686 4.4233496544471E-4
group 4 medulloblastoma 1875 0.00219165600131911
oligodendroglioma 2849 0.00506748500275812
primary pancreatic ductal adenocarcinoma 1271 0.00818600939785084
pediatric high grade glioma 2712 0.00942350409388521
aldosterone-producing adenoma 664 0.011361699521234
glioblastoma 5572 0.023608259198944
atypical teratoid / rhabdoid tumor 4369 0.0261307928241673
Breast cancer 3099 0.0272551137002533
pilocytic astrocytoma 3086 0.0306040724822255

Expression

Synonym

Accession Q7Z6I8 D3DQA7 Q86Y53 Q8N1T9
Symbols

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG Inparanoid

 Compartment GO Term (1)

AA Sequence

MMHPVASSNPAFCGPGKPSCLNEDAMRAADQFDIYSSQQSKYSHTVNHKPMVCQRQDPLNETHLQTTSGR      1 - 70
SIEIKDELKKKKNLNRSGKRGRPSGTTKSAGYRTSTGRPLGTTKAAGFKTSPGRPLGTTKAAGYKVSPGR     71 - 140
PPGSIKALSRLADLGYGCGTAAFPYPMMHGRAVHGVEETSSEVKPPNE                          141 - 188
//

Text Mined References (10)

PMID Year Title
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.