Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

 Compartment GO Term (1)

AA Sequence

MMHPVASSNPAFCGPGKPSCLNEDAMRAADQFDIYSSQQSKYSHTVNHKPMVCQRQDPLNETHLQTTSGR      1 - 70
SIEIKDELKKKKNLNRSGKRGRPSGTTKSAGYRTSTGRPLGTTKAAGFKTSPGRPLGTTKAAGYKVSPGR     71 - 140
PPGSIKALSRLADLGYGCGTAAFPYPMMHGRAVHGVEETSSEVKPPNE                          141 - 188
//

Text Mined References (11)

PMID Year Title