Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.24
PubTator Score 1.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma 1.300 1.6e-03
Astrocytoma, Pilocytic 1.300 4.7e-07
atypical teratoid / rhabdoid tumor -1.200 6.4e-04
glioblastoma 1.300 1.4e-02
group 4 medulloblastoma -1.100 1.8e-02
interstitial cystitis 2.000 1.5e-03
lung carcinoma -1.300 1.8e-22
medulloblastoma, large-cell -1.200 4.7e-03
non primary Sjogren syndrome sicca 1.600 1.7e-02
non-small cell lung cancer -1.628 5.2e-15
osteosarcoma -3.308 1.6e-04
primary pancreatic ductal adenocarcinoma -1.093 2.4e-02
spina bifida 1.026 4.1e-02
subependymal giant cell astrocytoma 1.920 1.9e-02
ulcerative colitis 2.100 7.4e-05

Gene RIF (2)

AA Sequence

MKSRQKGKKKGSAKERVFGCDLQEHLQHSGQEVPQVLKSCAEFVEEYGVVDGIYRLSGVSSNIQKLRQEF      1 - 70
ESERKPDLRRDVYLQDIHCVSSLCKAYFRELPDPLLTYRLYDKFAEAVGVQLEPERLVKILEVLRELPVP     71 - 140
NYRTLEFLMRHLVHMASFSAQTNMHARNLAIVWAPNLLRSKDIEASGFNGTAAFMEVRVQSIVVEFILTH    141 - 210
VDQLFGGAALSGGEVESGWRSLPGTRASGSPEDLMPRPLPYHLPSILQAGDGPPQMRPYHTIIEIAEHKR    211 - 280
KGSLKVRKWRSIFNLGRSGHETKRKLPRGAEDREDKSNKGTLRPAKSMDSLSAAAGASDEPEGLVGPSSP    281 - 350
RPSPLLPESLENDSIEAAEGEQEPEAEALGGTNSEPGTPRAGRSAIRAGGSSRAERCAGVHISDPYNVNL    351 - 420
PLHITSILSVPPNIISNVSLARLTRGLECPALQHRPSPASGPGPGPGLGPGPPDEKLEASPASSPLADSG    421 - 490
PDDLAPALEDSLSQEVQDSFSFLEDSSSSEPEWVGAEDGEVAQAEAAGAAFSPGEDDPGMGYLEELLGVG    491 - 560
PQVEEFSVEPPLDDLSLDEAQFVLAPSCCSLDSAGPRPEVEEENGEEVFLSAYDDLSPLLGPKPPIWKGS    561 - 630
GSLEGEAAGCGRQALGQGGEEQACWEVGEDKQAEPGGRLDIREEAEGSPETKVEAGKASEDRGEAGGSQE    631 - 700
TKVRLREGSREETEAKEEKSKGQKKADSMEAKGVEEPGGDEYTDEKEKEIEREEDEQREEAQVEAGRDLE    701 - 770
QGAQEDQVAEEKWEVVQKQEAEGVREDEDKGQREKGYHEARKDQGDGEDSRSPEAATEGGAGEVSKERES    771 - 840
GDGEAEGDQRAGGYYLEEDTLSEGSGVASLEVDCAKEGNPHSSEMEEVAPQPPQPEEMEPEGQPSPDGCL    841 - 910
CPCSLGLGGVGMRLASTLVQVQQVRSVPVVPPKPQFAKMPSAMCSKIHVAPANPCPRPGRLDGTPGERAW    911 - 980
GSRASRSSWRNGGSLSFDAAVALARDRQRTEAQGVRRTQTCTEGGDYCLIPRTSPCSMISAHSPRPLSCL    981 - 1050
ELPSEGAEGSGSRSRLSLPPREPQVPDPLLSSQRRSYAFETQANPGKGEGL                      1051 - 1101
//

Text Mined References (12)

PMID Year Title