Property Summary

NCBI Gene PubMed Count 30
PubMed Score 26.81
PubTator Score 263.42

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q7Z6E9 Q147T5 Q15290 Q6DKH4 Q6P4C2 Q6YNC9 Q7Z6E8 Q8N0V2 Q96PH3 Q9H3I8 Q9H5M5 Q9NPX4
Symbols PACT
MY038
P2P-R
RBQ-1
SNAMA

Gene

PANTHER Protein Class (2)

PDB

2C7H   2YSA   2YUR   3ZTG  

Gene RIF (15)

PMID Text
26905308 These results suggest that the RBBP6-3 isoform may be involved in promoting apoptosis in cancerous cells.
26574608 RBBP6 is a candidate gene for myeloproliferative neoplasms (MPNs) susceptibility in a subset of pedigrees with familial MPN.
25910411 High expression levels of RBBP6 and high apoptosis levels were found in HIV-associated nephropathy (HIVAN) cases. This direct association between RBBP6 expression and apoptosis levels suggests that RBBP6 play a role in HIVAN pathogenesis.
25505242 The interaction of HIV-1 CA with human cellular retinoblastoma binding protein 6 (RBBP6) is identified by yeast two-hybrid screen
25319826 implicate RBBP6 and iso3 as novel regulators of 3' processing, especially of RNAs with AU-rich 3' UTRs.
25127414 RBBP6 gene variants are associated with glioma and contribute to glioma susceptibility
24726359 RBBP6 prevents DNA damage by destabilizing the transcriptional repressor ZBTB38.
24703106 gene silencing sensitises breast cancer cells to staurosporine and camptothecin-induced cell death
22163034 AGO2, PACT and TRBP are required for the efficient functioning of Dicer in cells
22139301 these findings suggest that RBBP6 isoform 3 is a cell cycle regulator and may be deregulated in carcinogenesis
More...

AA Sequence

MSCVHYKFSSKLNYDTVTFDGLHISLCDLKKQIMGREKLKAADCDLQITNAQTKEEYTDDNALIPKNSSV      1 - 70
IVRRIPIGGVKSTSKTYVISRTEPAMATTKAIDDSSASISLAQLTKTANLAEANASEEDKIKAMMSQSGH     71 - 140
EYDPINYMKKPLGPPPPSYTCFRCGKPGHYIKNCPTNGDKNFESGPRIKKSTGIPRSFMMEVKDPNMKGA    141 - 210
MLTNTGKYAIPTIDAEAYAIGKKEKPPFLPEEPSSSSEEDDPIPDELLCLICKDIMTDAVVIPCCGNSYC    211 - 280
DECIRTALLESDEHTCPTCHQNDVSPDALIANKFLRQAVNNFKNETGYTKRLRKQLPPPPPPIPPPRPLI    281 - 350
QRNLQPLMRSPISRQQDPLMIPVTSSSTHPAPSISSLTSNQSSLAPPVSGNPSSAPAPVPDITATVSISV    351 - 420
HSEKSDGPFRDSDNKILPAAALASEHSKGTSSIAITALMEEKGYQVPVLGTPSLLGQSLLHGQLIPTTGP    421 - 490
VRINTARPGGGRPGWEHSNKLGYLVSPPQQIRRGERSCYRSINRGRHHSERSQRTQGPSLPATPVFVPVP    491 - 560
PPPLYPPPPHTLPLPPGVPPPQFSPQFPPGQPPPAGYSVPPPGFPPAPANLSTPWVSSGVQTAHSNTIPT    561 - 630
TQAPPLSREEFYREQRRLKEEEKKKSKLDEFTNDFAKELMEYKKIQKERRRSFSRSKSPYSGSSYSRSSY    631 - 700
TYSKSRSGSTRSRSYSRSFSRSHSRSYSRSPPYPRRGRGKSRNYRSRSRSHGYHRSRSRSPPYRRYHSRS    701 - 770
RSPQAFRGQSPNKRNVPQGETEREYFNRYREVPPPYDMKAYYGRSVDFRDPFEKERYREWERKYREWYEK    771 - 840
YYKGYAAGAQPRPSANRENFSPERFLPLNIRNSPFTRGRREDYVGGQSHRSRNIGSNYPEKLSARDGHNQ    841 - 910
KDNTKSKEKESENAPGDGKGNKHKKHRKRRKGEESEGFLNPELLETSRKSREPTGVEENKTDSLFVLPSR    911 - 980
DDATPVRDEPMDAESITFKSVSEKDKRERDKPKAKGDKTKRKNDGSAVSKKENIVKPAKGPQEKVDGERE    981 - 1050
RSPRSEPPIKKAKEETPKTDNTKSSSSSQKDEKITGTPRKAHSKSAKEHQETKPVKEEKVKKDYSKDVKS   1051 - 1120
EKLTTKEEKAKKPNEKNKPLDNKGEKRKRKTEEKGVDKDFESSSMKISKLEVTEIVKPSPKRKMEPDTEK   1121 - 1190
MDRTPEKDKISLSAPAKKIKLNRETGKKIGSTENISNTKEPSEKLESTSSKVKQEKVKGKVRRKVTGTEG   1191 - 1260
SSSTLVDYTSTSSTGGSPVRKSEEKTDTKRTVIKTMEEYNNDNTAPAEDVIIMIQVPQSKWDKDDFESEE   1261 - 1330
EDVKSTQPISSVGKPASVIKNVSTKPSNIVKYPEKESEPSEKIQKFTKDVSHEIIQHEVKSSKNSASSEK   1331 - 1400
GKTKDRDYSVLEKENPEKRKNSTQPEKESNLDRLNEQGNFKSLSQSSKEARTSDKHDSTRASSNKDFTPN   1401 - 1470
RDKKTDYDTREYSSSKRRDEKNELTRRKDSPSRNKDSASGQKNKPREERDLPKKGTGDSKKSNSSPSRDR   1471 - 1540
KPHDHKATYDTKRPNEETKSVDKNPCKDREKHVLEARNNKESSGNKLLYILNPPETQVEKEQITGQIDKS   1541 - 1610
TVKPKPQLSHSSRLSSDLTRETDEAAFEPDYNESDSESNVSVKEEESSGNISKDLKDKIVEKAKESLDTA   1611 - 1680
AVVQVGISRNQSHSSPSVSPSRSHSPSGSQTRSHSSSASSAESQDSKKKKKKKEKKKHKKHKKHKKHKKH   1681 - 1750
AGTEVELEKSQKHKHKKKKSKKNKDKEKEKEKDDQKVKSVTV                               1751 - 1792
//

Text Mined References (43)

PMID Year Title
26905308 2016 Expression analysis and association of RBBP6 with apoptosis in colon cancers.
26574608 2016 Germline RBBP6 mutations in familial myeloproliferative neoplasms.
25910411 2015 The association of RBBP6 variant 3 expressions with apoptosis in human immunodeficiency virus-associated nephropathy (HIVAN).
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25319826 2014 RBBP6 isoforms regulate the human polyadenylation machinery and modulate expression of mRNAs with AU-rich 3' UTRs.
25127414 2014 Association of genetic variants in the retinoblastoma binding protein 6 gene with the risk of glioma: a case-control study in a Chinese Han population.
24726359 2014 The RBBP6/ZBTB38/MCM10 axis regulates DNA replication and common fragile site stability.
24703106 2014 Silencing RBBP6 (Retinoblastoma Binding Protein 6) sensitises breast cancer cells MCF7 to staurosporine and camptothecin-induced cell death.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
More...