Property Summary

NCBI Gene PubMed Count 18
PubMed Score 6.80
PubTator Score 8.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
psoriasis 6685 6.25541632952505E-9
osteosarcoma 7933 9.28167797363738E-8
glioblastoma 5572 2.69661182534835E-6
Pick disease 1893 1.38255145297684E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 2.43981675168808E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 3.09369598525415E-5
pediatric high grade glioma 2712 3.6475526721893E-5
tuberculosis and treatment for 3 months 327 1.06067903189681E-4
primary Sjogren syndrome 789 1.34519685737431E-4
medulloblastoma, large-cell 6234 1.78846742556931E-4
pilocytic astrocytoma 3086 2.96757628208856E-4
ovarian cancer 8492 4.57263976864658E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 8.97127806504197E-4
sonic hedgehog group medulloblastoma 1482 0.00101811003499591
atypical teratoid / rhabdoid tumor 4369 0.00144768199291928
astrocytic glioma 2241 0.00207121583936924
oligodendroglioma 2849 0.00444729594456906
ependymoma 2514 0.00522004800423419
primitive neuroectodermal tumor 3031 0.0083987626077926
Alzheimer's disease 644 0.0163313620240389
mucosa-associated lymphoid tissue lymphoma 480 0.0386320548375442
subependymal giant cell astrocytoma 2287 0.0475149867625154
gastric carcinoma 832 0.0489616926221888
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count
Thyroid Cancer, Nonmedullary, 2 6
Disease Target Count
Thyroid cancer, non-medullary, 2 4

Expression

Synonym

Accession Q7Z6B7 Q9H8A3 Q9P2P2 srGAP1
Symbols NMTC2
ARHGAP13

Gene

PANTHER Protein Class (2)

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

 GWAS Trait (1)

Gene RIF (9)

PMID Text
26026792 Mutations of the SLIT2-ROBO2 pathway genes SLIT2 and SRGAP1 confer risk for congenital anomalies of the kidney and urinary tract
26026080 The elevated miR-145 present in invasive glioblastoma cells (IM3 cells) targets and down-regulated srGAP1, thereby allowing downstream G-proteins to remain in their active state and promote the observed invasive phenotype
25150978 The interaction of betaPix with srGAP1 is critical for maintaining suppressive crosstalk between Cdc42 and RhoA during 3D collagen migration.
25134534 we identified a consistently replicated loci at 12q14.2 (rs11175194 in SRGAP1, P(meta) = 1.14 x 10(-7))
24006490 Data indicate that srGAP1 possesses a GAP activity specific to Rac1 and is recruited to lamellipodia in a Rac1-dependent manner.
23539728 genome-wide linkage analysis in populations in Ohio and Poland: Data suggest that missense mutations in SRGAP1 are associated with genetic predisposition to papillary thyroid carcinoma.
21060114 This study proposed that the expression of SRGAP1 in the anterior neocortex may mark the early location of the human motor cortex, including its corticospinal projection neurons, allowing further study of their early differentiation.
20237496 Observational study of gene-disease association. (HuGE Navigator)
12736724 FNBP2, ARHGAP13, ARHGAP14 and ARHGAP4 constitute the FNBP2 family characterized by FCH, RhoGAP and SH3 domains.

AA Sequence

MSTPSRFKKDKEIIAEYESQVKEIRAQLVEQQKCLEQQTEMRVQLLQDLQDFFRKKAEIETEYSRNLEKL      1 - 70
AERFMAKTRSTKDHQQYKKDQNLLSPVNCWYLLLNQVRRESKDHATLSDIYLNNVIMRFMQISEDSTRMF     71 - 140
KKSKEIAFQLHEDLMKVLNELYTVMKTYHMYHAESISAESKLKEAEKQEEKQIGRSGDPVFHIRLEERHQ    141 - 210
RRSSVKKIEKMKEKRQAKYSENKLKSIKARNEYLLTLEATNASVFKYYIHDLSDLIDCCDLGYHASLNRA    211 - 280
LRTYLSAEYNLETSRHEGLDIIENAVDNLEPRSDKQRFMEMYPAAFCPPMKFEFQSHMGDEVCQVSAQQP    281 - 350
VQAELMLRYQQLQSRLATLKIENEEVKKTTEATLQTIQDMVTIEDYDVSECFQHSRSTESVKSTVSETYL    351 - 420
SKPSIAKRRANQQETEQFYFMKLREYLEGSNLITKLQAKHDLLQRTLGEGHRAEYMTTRPPNVPPKPQKH    421 - 490
RKSRPRSQYNTKLFNGDLETFVKDSGQVIPLIVESCIRFINLYGLQHQGIFRVSGSQVEVNDIKNSFERG    491 - 560
ENPLADDQSNHDINSVAGVLKLYFRGLENPLFPKERFNDLISCIRIDNLYERALHIRKLLLTLPRSVLIV    561 - 630
MRYLFAFLNHLSQYSDENMMDPYNLAICFGPTLMPVPEIQDQVSCQAHVNEIIKTIIIHHETIFPDAKEL    631 - 700
DGPVYEKCMAGDDYCDSPYSEHGTLEEVDQDAGTEPHTSEDECEPIEAIAKFDYVGRSARELSFKKGASL    701 - 770
LLYHRASEDWWEGRHNGIDGLVPHQYIVVQDMDDTFSDTLSQKADSEASSGPVTEDKSSSKDMNSPTDRH    771 - 840
PDGYLARQRKRGEPPPPVRRPGRTSDGHCPLHPPHALSNSSVDLGSPSLASHPRGLLQNRGLNNDSPERR    841 - 910
RRPGHGSLTNISRHDSLKKIDSPPIRRSTSSGQYTGFNDHKPLDPETIAQDIEETMNTALNELRELERQS    911 - 980
TAKHAPDVVLDTLEQVKNSPTPATSTESLSPLHNVALRSSEPQIRRSTSSSSDTMSTFKPMVAPRMGVQL    981 - 1050
KPPALRPKPAVLPKTNPTIGPAPPPQGPTDKSCTM                                      1051 - 1085
//

Text Mined References (24)

PMID Year Title
26026792 2015 Mutations of the SLIT2-ROBO2 pathway genes SLIT2 and SRGAP1 confer risk for congenital anomalies of the kidney and urinary tract.
26026080 2015 MicroRNA-145 Promotes the Phenotype of Human Glioblastoma Cells Selected for Invasion.
25150978 2014 An extracellular-matrix-specific GEF-GAP interaction regulates Rho GTPase crosstalk for 3D collagen migration.
25134534 2014 Genome-wide association study identifies new susceptibility loci for epithelial ovarian cancer in Han Chinese women.
24006490 2013 srGAP1 regulates lamellipodial dynamics and cell migratory behavior by modulating Rac1 activity.
23539728 2013 SRGAP1 is a candidate gene for papillary thyroid carcinoma susceptibility.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22467852 2012 The F-BAR domains from srGAP1, srGAP2 and srGAP3 regulate membrane deformation differently.
21269460 2011 Initial characterization of the human central proteome.
21060114 2011 The corticofugal neuron-associated genes ROBO1, SRGAP1, and CTIP2 exhibit an anterior to posterior gradient of expression in early fetal human neocortex development.
More...