Property Summary

NCBI Gene PubMed Count 15
PubMed Score 8.01
PubTator Score 7.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Substance-Related Disorders 115 0.0 0.0
Disease Target Count P-value
malignant mesothelioma 3232 6.6e-07
Multiple myeloma 1332 5.4e-04
oligodendroglioma 2850 2.3e-02
ovarian cancer 8520 2.6e-02
progressive supranuclear palsy 676 3.1e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma -2.400 6.6e-07
Multiple myeloma 1.044 5.4e-04
oligodendroglioma -2.400 2.3e-02
ovarian cancer 1.300 2.6e-02
progressive supranuclear palsy -1.100 3.1e-02

Protein-protein Interaction (3)

Gene RIF (3)

AA Sequence

MDDDDFGGFEAAETFDGGSGETQTTSPAIPWAAFPAVSGVHLSPSSPEIVLDRDHSSSIGCLSSDAIISS      1 - 70
PENTHAANSIVSQTIPKAQIQQSTHTHLDISLFPLGLTDEKSNGTIALVDDSEDPGANVSNIQLQQKISS     71 - 140
LEIKLKVSEEEKQRIKQDVESLMEKHNVLEKGFLKEKEQEAISFQDRYKELQEKHKQELEDMRKAGHEAL    141 - 210
SIIVDEYKALLQSSVKQQVEAIEKQYISAIEKQAHKCEELLNAQHQRLLEMLDTEKELLKEKIKEALIQQ    211 - 280
SQEQKEILEKCLEEERQRNKEALVSAAKLEKEAVKDAVLKVVEEERKNLEKAHAEERELWKTEHAKDQEK    281 - 350
VSQEIQKAIQEQRKISQETVKAAIIEEQKRSEKAVEEAVKRTRDELIEYIKEQKRLDQVIRQRSLSSLEL    351 - 420
FLSCAQKQLSALIATEPVDIE                                                     421 - 441
//

Text Mined References (18)

PMID Year Title