Property Summary

NCBI Gene PubMed Count 15
PubMed Score 7.59
PubTator Score 7.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Multiple myeloma 1.044 0.001
malignant mesothelioma -2.400 0.000
oligodendroglioma -2.400 0.023
progressive supranuclear palsy -1.100 0.031
ovarian cancer 1.300 0.026

Synonym

Accession Q7Z6B0 B3KSA3 C9JR07 Q68D43 Q6IA78 Q8NEN7 Q9NUW9
Symbols p56
HSD8

Gene

PDB

1OM9  

Gene RIF (3)

PMID Text
20808825 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17596511 p56 tightly cooperates with the GGAs in the sorting of cathepsin D to lysosomes, probably by enabling the movement of GGA-containing transport carriers.

AA Sequence

MDDDDFGGFEAAETFDGGSGETQTTSPAIPWAAFPAVSGVHLSPSSPEIVLDRDHSSSIGCLSSDAIISS      1 - 70
PENTHAANSIVSQTIPKAQIQQSTHTHLDISLFPLGLTDEKSNGTIALVDDSEDPGANVSNIQLQQKISS     71 - 140
LEIKLKVSEEEKQRIKQDVESLMEKHNVLEKGFLKEKEQEAISFQDRYKELQEKHKQELEDMRKAGHEAL    141 - 210
SIIVDEYKALLQSSVKQQVEAIEKQYISAIEKQAHKCEELLNAQHQRLLEMLDTEKELLKEKIKEALIQQ    211 - 280
SQEQKEILEKCLEEERQRNKEALVSAAKLEKEAVKDAVLKVVEEERKNLEKAHAEERELWKTEHAKDQEK    281 - 350
VSQEIQKAIQEQRKISQETVKAAIIEEQKRSEKAVEEAVKRTRDELIEYIKEQKRLDQVIRQRSLSSLEL    351 - 420
FLSCAQKQLSALIATEPVDIE                                                     421 - 441
//

Text Mined References (18)

PMID Year Title
25064007 2014 A genome-wide association study identifies susceptibility loci for ossification of the posterior longitudinal ligament of the spine.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20808825 2010 Novel association strategy with copy number variation for identifying new risk Loci of human diseases.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17596511 2007 The trans-Golgi network accessory protein p56 promotes long-range movement of GGA/clathrin-containing transport carriers and lysosomal enzyme sorting.
More...