Property Summary

NCBI Gene PubMed Count 45
PubMed Score 138.00
PubTator Score 66.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 1.3e-04
interstitial cystitis 2312 2.9e-02
Disease Target Count Z-score Confidence
Cancer 2499 3.222 1.6
Xanthogranulomatous cholecystitis 3 3.051 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
interstitial cystitis 1.900 2.9e-02
osteosarcoma -1.824 1.3e-04

Gene RIF (41)

AA Sequence

MKTLPAMLGTGKLFWVFFLIPYLDIWNIHGKESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVT      1 - 70
WCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSAS     71 - 140
ERPSKDEMASRPWLLYRLLPLGGLPLLITTCFCLFCCLRRHQGKQNELSDTAGREINLVDAHLKSEQTEA    141 - 210
STRQNSQVLLSETGIYDNDPDLCFRMQEGSEVYSNPCLEENKPGIVYASLNHSVIGPNSRLARNVKEAPT    211 - 280
EYASICVRS                                                                 281 - 289
//

Text Mined References (46)

PMID Year Title