Property Summary

NCBI Gene PubMed Count 39
Grant Count 115
R01 Count 74
Funding $10,604,826.64
PubMed Score 129.13
PubTator Score 66.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.824 0.000
interstitial cystitis 1.900 0.029

Synonym

Accession Q7Z6A9 Q3B831 Q3HS85 Q6ZNH9
Symbols BTLA1
CD272

Gene

PDB

2AW2  

Gene RIF (35)

PMID Text
26277622 BTLA expression declines on B cells of the aged and is associated with low responsiveness to the trivalent influenza vaccine.
26137961 our study confirms that CD200/BTLA deletions are recurrent genetic lesions in the biology of BCP-ALL
25334051 high BTLA expression levels in gastric cancer, identified by IHC, are an independent biomarker for the poor prognosis of patients with gastric cancer.
25261097 Focal deletions of the BTLA were associated with B-cell precursor acute lymphoblastic leukemia.
24909289 Data indicate taht lung function and the expressions of B, T lymphocyte attenuator (BTLA) and Treg cells were lower in patients with rheumatism than those in normal controls.
24162774 HIV-1 gp120 downregulates the expression of B and T lymphocyte associated protein (BTLA) in human B cells
23692853 BTLA is a coreceptor that negatively regulates human Vgamma9Vdelta2 T-cell proliferation and has a role in immune escape for lymphoma cells
23375291 BTLA and HVEM may have roles in graft rejection after kidney transplantation
22903545 BTLA regulates human B cell responses and has implications for future development of therapies modulating B cells.
22691359 The expression of BTLA has been observed on the surface of several kinds of cells within synovial tissues of RA patients, which indicates this signal might be involved in the regulation of local T cell activation and the pathogenesis of RA.
More...

AA Sequence

MKTLPAMLGTGKLFWVFFLIPYLDIWNIHGKESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVT      1 - 70
WCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSAS     71 - 140
ERPSKDEMASRPWLLYRLLPLGGLPLLITTCFCLFCCLRRHQGKQNELSDTAGREINLVDAHLKSEQTEA    141 - 210
STRQNSQVLLSETGIYDNDPDLCFRMQEGSEVYSNPCLEENKPGIVYASLNHSVIGPNSRLARNVKEAPT    211 - 280
EYASICVRS                                                                 281 - 289
//

Text Mined References (40)

PMID Year Title
26277622 2015 BTLA expression declines on B cells of the aged and is associated with low responsiveness to the trivalent influenza vaccine.
26137961 2015 CD200/BTLA deletions in pediatric precursor B-cell acute lymphoblastic leukemia treated according to the EORTC-CLG 58951 protocol.
25334051 2015 Ectopic expression of B and T lymphocyte attenuator in gastric cancer: a potential independent prognostic factor in patients with gastric cancer.
25261097 2015 Novel gene targets detected by genomic profiling in a consecutive series of 126 adults with acute lymphoblastic leukemia.
24909289 2014 [The decline in lung function is associated with a decrease in the number of BTLA? lymphocytes and regulatory T cells in patients with rheumatism].
23692853 2013 The co-receptor BTLA negatively regulates human V?9V?2 T-cell proliferation: a potential way of immune escape for lymphoma cells.
23375291 B- and T-lymphocyte attenuator/herpes virus entry mediator as early indicators for acute rejection following kidney transplantation.
22903545 2013 CpG-ODN-induced sustained expression of BTLA mediating selective inhibition of human B cells.
22691359 2012 [Expression of the costimulatory molecule BTLA in synovial tissues from rheumatoid arthritis patients].
22634623 2012 B and T lymphocyte attenuator mediates inhibition of tumor-reactive CD8+ T cells in patients after allogeneic stem cell transplantation.
More...