Property Summary

NCBI Gene PubMed Count 45
Grant Count 7
R01 Count 3
Funding $422,719.06
PubMed Score 72.53
PubTator Score 50.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
astrocytic glioma -1.500 0.002
ependymoma -1.100 0.040
osteosarcoma 1.671 0.011
glioblastoma 2.200 0.002
medulloblastoma -1.600 0.000
atypical teratoid / rhabdoid tumor 1.900 0.003
medulloblastoma, large-cell -2.500 0.001
tuberculosis and treatment for 3 months 1.200 0.009
intraductal papillary-mucinous adenoma (... 1.200 0.019
ulcerative colitis 1.100 0.000
Breast cancer 3.900 0.040
pediatric high grade glioma 1.600 0.005
pilocytic astrocytoma 1.800 0.000
aldosterone-producing adenoma -1.211 0.009
Polycystic Ovary Syndrome -1.021 0.002
lung carcinoma -1.200 0.000
Pick disease -1.200 0.000
gastric carcinoma 1.100 0.008
acute myeloid leukemia -2.000 0.022
ovarian cancer 2.500 0.000

Synonym

Accession Q7Z699 B2RPJ8 Q05D53 Q8N256 Spred-1
Symbols NFLS
hSpred1
spred-1
PPP1R147

Gene

PANTHER Protein Class (1)

PDB

3SYX  

Gene RIF (29)

PMID Text
26635368 Data suggest SPRED1 EVH1 domain interacts with NF1 GRD domain [N-term. 16AA/C-term. 20AA of GTPase-activating protein-related domain]; SPRED1 EVH1 and NF1 GRD mutations observed in Legius syndrome reduce binding affinity between EVH1/GRD domains.
26075267 Cosuppression of Sprouty and Sprouty-related negative regulators of FGF signalling in prostate cancer
25202123 Antisense-mediated knockdown (anti-miR) revealed that miR-206/21 coordinately promote RAS-ERK signaling and the corresponding cell phenotypes by inhibiting translation of the pathway suppressors RASA1 and SPRED1.
24469042 SPRED1 decreased expression correlated with genetic features of AML. Our study reveals a new mechanism which contributes to deregulate RAS MAPK pathway in the vast majority of paediatric AMLs
24334617 SPRED1 seems to play an important role in recruiting neurofibromin to the plasma membrane. (Review)
24014835 Microrna-126 was transported into recipient human coronary artery endothelial cells by endothelial microparticles and functionally regulated the target protein sprouty-related, EVH1 domain-containing protein 1 (SPRED1).
23823658 Older age and deletions of IKZF1 and SPRED1 were also associated with poor overall survival of pediatric B-cell precursor acute lymphoblastic leukemia.
23811937 Data indicate that upregulated miR-126 upon coxsackievirus B3 (CVB3) infection targets SPRED1, LRP6, and WRCH1 genes, mediating cross-talk between ERK1/2 and Wnt/beta-catenin pathways, and thus promoting viral replication.
23016555 Based on our current understanding of KIT and SPRED1 protein interactions, we propose that cafe-au-lait macules and freckling may be seen in some patients with piebaldism and does not necessarily represent coexistence of neurofibromatosis type 1.
22753041 Sixty-three mutations and deletions are definitely pathogenic or most likely pathogenic, eight SPRED1 mutations are probably benign rare variants, and 17 SPRED1 missense mutations are still unclassified. Review.
More...

AA Sequence

MSEETATSDNDNSYARVRAVVMTRDDSSGGWLPLGGSGLSSVTVFKVPHQEENGCADFFIRGERLRDKMV      1 - 70
VLECMLKKDLIYNKVTPTFHHWKIDDKKFGLTFQSPADARAFDRGIRRAIEDISQGCPESKNEAEGADDL     71 - 140
QANEEDSSSSLVKDHLFQQETVVTSEPYRSSNIRPSPFEDLNARRVYMQSQANQITFGQPGLDIQSRSME    141 - 210
YVQRQISKECGSLKSQNRVPLKSIRHVSFQDEDEIVRINPRDILIRRYADYRHPDMWKNDLERDDADSSI    211 - 280
QFSKPDSKKSDYLYSCGDETKLSSPKDSVVFKTQPSSLKIKKSKRRKEDGERSRCVYCQERFNHEENVRG    281 - 350
KCQDAPDPIKRCIYQVSCMLCAESMLYHCMSDSEGDFSDPCSCDTSDDKFCLRWLALVALSFIVPCMCCY    351 - 420
VPLRMCHRCGEACGCCGGKHKAAG                                                  421 - 444
//

Text Mined References (51)

PMID Year Title
26635368 2016 Interaction between a Domain of the Negative Regulator of the Ras-ERK Pathway, SPRED1 Protein, and the GTPase-activating Protein-related Domain of Neurofibromin Is Implicated in Legius Syndrome and Neurofibromatosis Type 1.
26075267 2015 Cosuppression of Sprouty and Sprouty-related negative regulators of FGF signalling in prostate cancer: a working hypothesis.
25202123 2014 MicroRNAs 206 and 21 cooperate to promote RAS-extracellular signal-regulated kinase signaling by suppressing the translation of RASA1 and SPRED1.
24705354 2014 The palmitoyl acyltransferase HIP14 shares a high proportion of interactors with huntingtin: implications for a role in the pathogenesis of Huntington's disease.
24469042 2015 SPRED1, a RAS MAPK pathway inhibitor that causes Legius syndrome, is a tumour suppressor downregulated in paediatric acute myeloblastic leukaemia.
24334617 2013 Legius syndrome, an Update. Molecular pathology of mutations in SPRED1.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
24014835 2013 Endothelial microparticle-mediated transfer of MicroRNA-126 promotes vascular endothelial cell repair via SPRED1 and is abrogated in glucose-damaged endothelial microparticles.
23823658 2014 Deletions of IKZF1 and SPRED1 are associated with poor prognosis in a population-based series of pediatric B-cell precursor acute lymphoblastic leukemia diagnosed between 1992 and 2011.
23811937 2013 MiR-126 promotes coxsackievirus replication by mediating cross-talk of ERK1/2 and Wnt/?-catenin signal pathways.
More...