Property Summary

NCBI Gene PubMed Count 38
PubMed Score 19.95
PubTator Score 13.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma -1.500 1.8e-02
interstitial cystitis -1.400 1.6e-04
medulloblastoma, large-cell -1.300 2.1e-02
ovarian cancer -1.100 1.6e-03
tuberculosis -1.900 2.6e-05

Protein-protein Interaction (8)

Gene RIF (20)

AA Sequence

MTEETHPDDDSYIVRVKAVVMTRDDSSGGWFPQEGGGISRVGVCKVMHPEGNGRSGFLIHGERQKDKLVV      1 - 70
LECYVRKDLVYTKANPTFHHWKVDNRKFGLTFQSPADARAFDRGVRKAIEDLIEGSTTSSSTIHNEAELG     71 - 140
DDDVFTTATDSSSNSSQKREQPTRTISSPTSCEHRRIYTLGHLHDSYPTDHYHLDQPMPRPYRQVSFPDD    141 - 210
DEEIVRINPREKIWMTGYEDYRHAPVRGKYPDPSEDADSSYVRFAKGEVPKHDYNYPYVDSSDFGLGEDP    211 - 280
KGRGGSVIKTQPSRGKSRRRKEDGERSRCVYCRDMFNHEENRRGHCQDAPDSVRTCIRRVSCMWCADSML    281 - 350
YHCMSDPEGDYTDPCSCDTSDEKFCLRWMALIALSFLAPCMCCYLPLRACYHCGVMCRCCGGKHKAAA      351 - 418
//

Text Mined References (40)

PMID Year Title