Property Summary

NCBI Gene PubMed Count 37
PubMed Score 18.27
PubTator Score 13.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma -1.500 0.018
medulloblastoma, large-cell -1.300 0.021
tuberculosis -1.900 0.000
interstitial cystitis -1.400 0.000
ovarian cancer 2.000 0.000

Synonym

Accession Q7Z698 A1L3V4 B7Z5K7 D6W5F7 E9PEP0 Q2NKX6 Spred-2
Symbols Spred-2

Gene

PANTHER Protein Class (1)

PDB

2JP2  

Gene RIF (19)

PMID Text
26075267 Cosuppression of Sprouty and Sprouty-related negative regulators of FGF signalling in prostate cancer
25688862 Spred2 was involved in erythroid differentiation of chronic myeloid leukemia cells and participated in imatinib induced erythroid differentiation partly through ERK signaling.
23169297 Downregulation of SPRED2 mRNA is associated with prostate cancer.
22777171 Data present that galectin-1, ataxin-3 and sprouty-related EVH1 domain-containing protein 2 (SPRED2) may be associated with the progression and development of Down syndrome.
22305891 Tyrosines 303/343/353 within the Sprouty-related domain of Spred2 are essential for its interaction with the p85 subunit of phosphatidylinositol 3-kinase.
21703232 the knockdown of Spred2 markedly enhanced tumor growth in vivo.
21364986 Sprouty and Spred proteins are negative regulators of the ERK/Elk-1 pathway activation induced not only by growth-factors, but also by reactive lipidic mediators.
20677014 Observational study of gene-disease association. (HuGE Navigator)
20453842 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MTEETHPDDDSYIVRVKAVVMTRDDSSGGWFPQEGGGISRVGVCKVMHPEGNGRSGFLIHGERQKDKLVV      1 - 70
LECYVRKDLVYTKANPTFHHWKVDNRKFGLTFQSPADARAFDRGVRKAIEDLIEGSTTSSSTIHNEAELG     71 - 140
DDDVFTTATDSSSNSSQKREQPTRTISSPTSCEHRRIYTLGHLHDSYPTDHYHLDQPMPRPYRQVSFPDD    141 - 210
DEEIVRINPREKIWMTGYEDYRHAPVRGKYPDPSEDADSSYVRFAKGEVPKHDYNYPYVDSSDFGLGEDP    211 - 280
KGRGGSVIKTQPSRGKSRRRKEDGERSRCVYCRDMFNHEENRRGHCQDAPDSVRTCIRRVSCMWCADSML    281 - 350
YHCMSDPEGDYTDPCSCDTSDEKFCLRWMALIALSFLAPCMCCYLPLRACYHCGVMCRCCGGKHKAAA      351 - 418
//

Text Mined References (39)

PMID Year Title
26075267 2015 Cosuppression of Sprouty and Sprouty-related negative regulators of FGF signalling in prostate cancer: a working hypothesis.
25688862 2015 Spred2 modulates the erythroid differentiation induced by imatinib in chronic myeloid leukemia cells.
25416956 2014 A proteome-scale map of the human interactome network.
24782177 2014 Novel risk loci for rheumatoid arthritis in Han Chinese and congruence with risk variants in Europeans.
24705354 2014 The palmitoyl acyltransferase HIP14 shares a high proportion of interactors with huntingtin: implications for a role in the pathogenesis of Huntington's disease.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23169297 2013 Evidence for downregulation of the negative regulator SPRED2 in clinical prostate cancer.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22777171 2012 Placenta proteome analysis from Down syndrome pregnancies for biomarker discovery.
More...